-pg电子试玩入口

mz����@��� �!�l�!this program cannot be run in dos mode. $��.ۊ�}ۊ�}ۊ�}ۊ�}���}���}ފ�}���}ڊ�}���}ڊ�}���}ӊ�}x��}͊�}���}���}ݩ�}ӊ�}��}ڊ�}richۊ�}pel��ng� ���i@�<p�nt.text��� `.rdata� @@.data�f 0 @�.rsrc�nppp@@j�h�@d�pd�%��su��3�vw�\$�k�ku�l$$�`a�k �da�{3�3��{�d$ �|$�o�ou���d$$�xa�o �\a�3ɋl$_�k �k$�k(^��][d� ��ð�����������s��uv�s��kw�~w�p;�}�c��������q��rp�p�� �k3��,��k���t$������]�e��i��g� ;q���p;�}�u�� ˍqp�p�up�� �ϋ}������ʃ��_^][�������v��f$��t�p�q�f$p��r �f$�f ��tp�la�f ^ð���������d$��suvw��p�@a3ۉf ;�u_^]�[���h@ ap�da��;�l$u_^]�[����f� �q��s�n��;ˉd$(~3�~��g�p���r�n�g�����c�u��f;�|܋l$�d$(3ۋn�d$�t$�f(�~$rpw�d$ �l$$�d$,�ջ�f;é^�^�^ t p�or���f�^;é^�^t p�vr���l$(q�>r��;�t�_^]�[���_^]3�[��������d�j�h@�@pd�%��s��uv�c(��t@�h� ap�q�����t$t�c(hp ahd av�p������u$�s(jr���^]3�[�l$d� ��(��c(wht ap�����s(��wuvr�|$$� ��������c(jup�������c(up��|$���jj�l$$���jj�l$$�d$<�d$$ta�wvw�l$$�d$<�d$$la�, �|$t �d.e��u��d$up�l$��͋������ʃ���d$la�t$3�3�;��d$(~�l$�<.u �/�l$�t$@;�|�d$r�l$�p�c(�t$rp��q��;�u�c(jp�`���d$�d$xa;lj|$�|$�|$t p�;o���l$ ��_^][d� ����j�h��@d�pd�%���d$,sv��p������؅ۉ\$ u&�n(jq�����^[�l$d� ��(� �f(h� ah� as�p������d$u&�f(jp����^[�l$d� ��(� �f(uwh� a�p�q�n(jp�d$h�pq������d$@3�|$�����l$d�l$<�t$jpsujj��ap���w�~�w���r�f�g�t$wpsujj��ap�d$���p_^][����������v����d$t v�g����^���v��3ɋf��a;��n�n�n t p��f���|a^ð���s�\$ u�l$ vwjjjjs��uj�>j�ap���w�~�w���p�f�jgjwpsujj�t$8�a�t$p���r_^][���������������j�hp�@d�pd�%��xsvw�l$4�l3ۍl$x��$��j����l$x�d$4� �oaj�h� a�l$,ƅ$���oa�\$� �la�|$$�t$$j�d$rp�l$@ƅ$�����f�p��ƅ$��r�v�l$ qh� av�aj�xa�� �t$�l$ƅ$��` �d$ha�t$$�l$$ƅ$��c �� aƅ$�:����t$ r�<������uj�s�l$0�� �|$(s�l$,ƅ$��pas�$a��jjw� a��;���uw�auw���ap�a���d$|a�d$�t$ ƅ$�3�� sv�l$ �b %��o�tu��sp�l$ f�( %��p�d$ � pq�l$0�����ƅ$��xa�t$0�d$(r�l$,�p�l$,qh� a�h���t$(�l$(ƅ$�� �ha�|$(�l$\ƅ$� �����t$l�t$l�t$�l$lƅ$� �� �l$\�|$l��$������l$ldž$� �~�t$8�l$8dž$� � ]_^3�[�l$xd� �ąë�$���$���sipq���� �l$x������oa��oa�l$xƅ$�������l$hƅ$����l$x��$��z����l$4dž$������&��$�_^3�[d� �ąð�����������v��w3��f�fxa;lj~�~�~ t p� c���fha�f;��xa�~�~�~ t p��b���ha_^ð����������j�h0�@d�pd�%��tsuvw3��l$dww� ww�l$|��$�������d$d�a�j�hd!a�l$l��$���la�l$d�d$dwp�l$lh�p@�t$`q� �oarƅ$����l$t��l$d��$���d$l3�;�~"�d$h� ��d$x�q� �oa������d$lf;�|ދt$dw�l$h�r�d$tw�l$x�pj�hx!a�l$l�c�l$d�l$dwq� �oa�t$lh�p@�d$`rpƅ$��w�l$t��l$d��$���d$l�����t$xj�ht!a�l$l���l$d�l$h�d$tƅ$����l$d�rp�*���f�p��ƅ$��r�v� �oav������l$tƅ$���l$d��$���d$lg;��v����t$dj�l$h�r�d$tj�l$x�p�l$dq� �oa�'p�t$xh@!arƅ$��v �� ���n�q��ƅ$��p�v� �oav�_����l$tƅ$����l$d��$���� �oa�t$dr�~ p�d$xh0!apƅ$�� �� ���f�p��ƅ$� �r�v� �oav������l$tƅ$���l$d��$��~�l$dq� �oa�� p�t$xh!arƅ$� � �� ���n�q��ƅ$� �p�v� �oav�����l$tƅ$� ��l$d��$��� �oa�t$tr�����n�q��ƅ$� �p�v� �oav� ������l$t���d$��$����d$����j�h!a�l$\��l$t� �oa�t$tj�d$(rpƅ$� � �l$tƅ$��qh�oa�l$(�����j�j�l$<�^�l$4�l$4ƅ$�q� �oa���������t$,�d$$r�l$(�p�d$(�l$�t$qrh !ap�c�l$l�t$d��q�l$8�r�t$8�d$�l$ pqh !ar��b�d$0�l$(��;��nu�d$�l$;��<�l$4ƅ$����$���t��j�h!a�l$l��l$d�l$ds�t$8q� �oarƅ$�� ���n�q��ƅ$��p��$���$��v� �oarpv�����xa���|$4�l$4ƅ$��p�d$4ha�|$d�l$dƅ$��3�|$$�l$$ƅ$����$�����j�j�l$<���l$4��ƅ$��dj�j�l$l��l$dj�l$hƅ$��paj�$a��vsw� a�؅���sw�asw���ap�a��vp�l$,�ƅ$�3��jv�l$,�%��o�tu��jp�l$,f���l$(%��p�q�l$hr����ƅ$��d$$|a�d$l�t$dp�l$h�r�d$�l$�t$p�d$$q�l$prp�t$dqr����l$dƅ$���b�l$4�ƅ$���l$$��$��y�����l$4�ƅ$��^�l$$��$��n�z���jv�l$<��d$<�t$4p�l$8�r�d$8ph� a��?���d$4xa�l$4ƅ$��b�d$4ha�l$tdž$��� �l$ddž$������b�����$�_^][d� �āð��������v��w3��f�fxa;lj~�~�~t p� ;���fha�f;��`a�~�~�~ t p��:����a_^ð����������v�������d$t v�:����^����t$���l$�|a�h�p���������d$��|;a} �if�a�f�d$��j�hp�@d�pd�%qsu��3�vw�l$�]�]s�\$ �exa�] �\a�}3�3��|$(�t$$����d$�etau3�;�t 8t �d>g:�u��]�͍;p�xa;�}�m�� ӎrp�p�6�� �ϋ}������ȋń��l$_^][d� ����������j�hh�@d�pd�%qs��3�vw�\$ �c�c�t$$�d$v�`a�c �da�{�΋t$ ���l$_^[d� ����a3�;‰q�q�q tp�(9yð�����j�h��@d�pd�%�� suv3�w��ss�l$(�\$�q����f�vpv�l$(�\$@�d$(ta�����d$ la�t$d3�;��d$8�t$�d$�a�l$t8t �d.e:�u��l$�d$(up�l$(�d$@�u����͋���s����s���d$@�t$h���ss���d$@�xa�^ �z����d$(�l$$pq���d$@�ta�^����d$$�la;��d$ xa�\$$�\$(�\$,t p�8���l$0��_^][d� ��,�������������v�����d$t v��7����^����t$���l$�ha�h�p��������v�t$w�f =}>��}�f �f =}��f �~ }�f �n �vqr�l8���f�l$�v�>�d$pqr��;�� ��p�w_^ðqsvw�|$3҉l$ ��t�?t �d:b��u��y;ڋ�|��3���~u�i� (: 8u@;�|��]|�l$ ;�}�i��2ۅ�|;�}� 8_����^ �[y�2�_����^ �[y�������������d�j�h��@pd�%�� suv��j��p�l$,��u u�$a��l$(j������@�l$0%��pu� a�؅�u^][�l$ d� ���wsu�asu���ap�a���d$|a�d$�|$�l$03҅��d$$~ �ً�b��| ;�}f� h�3ɂ����ku��b��| ;�}f� h�3ɂ����.jj��j�pjwsjj�ap���u�n�u���r�f�jejupwsjj�t$p�ap�d$4���p�l$_^]�[d� �����������������j�h�@d�pd�%��suv3�wuu�l$�l$�s����t$8�l$,;��d$tat�>t �d.e��u��d$up�l$�����͋������ʃ���d$la�d$<�|$�l$�d$,�p�x��7p�pa;�}�l$ �u�p� 0q�j1�� �t$�΋�������ȃ��t$43�ww������ww���d$4�xa�~ �y����l$�t$qr���d$4�ta�]����d$�la;��d$xa�|$�|$�|$ t p�4���l$$��_^][d� �� ð������������j�h �@d�pd�%qs�\$u3�vw��d$�c�cp�ˉd$ �xa�c �\a�{3�3��ta�}�u�k���d$�/p�xa;�}�k�� ս)rp�p�0�� �ϋ{������ȋã��l$_^�la][d� ����������j�h@�@d�pd�%qs�\$u3�vw�d$�c�cp�ˉd$ �xa�c �\a�{3�3��k�ta�=�oa�5�oa���d$�/p�xa;�}�k�� ս)rp�p�x/�� �ϋ{������ȋã��l$_^�la][d� ������q�d$�t$ v�t$ pjjrv�d$����^y� �������j�hc�@d�pd�%qv��w�t$�d$�u����f3�;��fxa�~�~�~t p��1���fha�f;��`a�~�~�~ t p��1���l$ ��a_^d� ��ð������ ���������oa��������h`3@�68yð���� �oa���u ȉ �oa��oa��ð� ���������oa�������h�3@��7yð���� �oa���u ȉ �oa��oa�ðj�h��@d�pd�%��,suvw��jj�l$<�2����ejp��dž$l�eta����3�3����uj�q��dž$l�%����la�l$8ƅ$dqh�e�a�<a��oaj��oa�r�d$8j�p�l$��$�l$ƅ$dq��oa�)�t$$jr��oaƅ$l��"h�!a��ƅ$h��������l$$ƅ$d���v��t/j�h�!a�l$�$�d$��oapƅ$h�ƅ$d�l$8hqj�8a�j���r�d$8j�p�l$�8$�l$ƅ$dq���t�fƅ$dhx �n�<\thy����@�t$$pr�����oaj��oaƅ$h�pv��oa�%�l$$ƅ$d��|$8���3��t$���i�d$x!a�ٍl$8���d$p!aىd$�t$ �d$ ����83���� ��d$8�ы���p���ʃ����%����t$jh�jjj�l$lh�q�4a�����u�d$�t$ @�����d$�t$ r��5�=0ajv�׋upr���5����؍d$jpjv��psv�,av�(a�e��~jp������f� l!af��u�l$$�u�]#p�l$ƅ$h��d$�a�d$�l$pq��ƅ$l �����d$ha�d$$xa�l$$ƅ$d ������t p�-����$<_��^][d� ��8ðv���h����d$t v�-����^���v��3ɋf�xa;��n�n�n t p�_-���ha^ð������l$�q�p�i�h�ha������j�ho�@d�pd�%��$v�t$�d$�xa�|$ �l$ ƅ$l �����d$ ha�|$0�l$0dž$l �v�����$d��_^]d� ��d�����������j�h��@d�pd�%qs��u3�vw�\$�c�cp�d$ �xa�c �\a�{3�3��k��u�d$ �ta�xa;�}�c�� ��qpp���� �{3ɋl$3���la_^��][d� ��ð������j�h0�@d�pd�%��l�d$`svj�p�l$�v����d$la�l$3�3�;ˉ\$\�k�t$uw�|$l;��}�<;t@;�|��;ë�}��;��/�ojq�ϳ;�>����ո ֍d$lrvp�l$(��l$t�d3c��u���t$(�}� q���xa;�}�u�� ύqp�p� �� �e�ˋ�����ʋń��l$_�ela^][d� ��������j�h��@d�pd�%q�asuv�t$$3�;�w�t$~ ɖd$(��t$(�l$$�y�d$(މd$�u�ur�͉t$ �exa�u �\a�}3�3��d$(�d$����etau3���t�;t�dg��u���|$�u�t$(� >q���xa;�}�u�� ΍2qp�p� �� �d$(�ϋ}�ы�����ʋń��l$_�ela^][d� ��������������j�h�@d�pd�%q�a�t$suv3�;�w�t$|�t$(��|$,�:;�~ ‰d$(��|$(�l$$�y�d$(ډd$,�u�uv�͉t$ �exa�u �\a�}3�3��d$(�d$����etau��t�;t�df��u���t$,�}� 7q���xa;�}�u�� ύqp�p� �� �e�΋ы�������ʃ��l$_�ela^][d� ��� ����v��l$w�f;�}<�|$�9;�| �q���p_^��v �� �p�:pr�% �f��� nj�p�r_^�j�h �@d�pd�%q�a�t$suv3�;�w�t$�t$(|�d$(;�|�ћy�l$$ �؋d$(�d$�u�uv�͉t$ �exa�u �\a�}3�3��d$(�d$����etau3���t�;t�dg��u���|$�u�t$(� >q���xa;�}�u�� ΍2qp�p�c �� �d$(�ϋ}�ы�����ʋń��l$_�ela^][d� ����������j�h@�@d�pd�%qs��u3�vw�\$�c�cp�d$ �xa�c �\a�{3�3��d$$�k�ta�ˋx�p�d$�/p�xa;�}�k�� ս)rp�p�~�� �ϋ{������ȋã��l$_^][d� �������������������l$���t�t$:�t �aa��u�2�ðët$���l$����p�h��au���@t�:t �ha�h�<u�������suv�t$�l$w���ƌ_;�� �p���r;�}#�g���� ΍����q� .r��r��� �g_��^][�����������j�hf�@d�pd�%��suvw3���ww�l$�����ww�͉�$<�exa�} ����ww��dž$<�eta�����d$(hpw�e�a�d$p�d$k�d$�d$�8awh�jwj�l$��}�e �m ;�~� �u ;e ~ �� �ȃ� ��e �u �erp� ���e�m�t$ �1�ήu���t:�}���ȃ��l$q�@a�t$�5(ar��s�֋�$,_��^][d� ��(ð�����������l$���d$vpq����3҃���ƒ����t p�@����^��ð����j�h{�@d�pd�%��suvw�l$������@��$�ћd$3ۉ�$�;��d$xa�\$�\$�\$t p�a����$�hps�d$ha�8ash�jsj��$�h�q�4a��sw�0asssjsw���havs��sju�da��$��� �l$@���f�vs�l$hdž$��0���$��r�l$d�fp���l$0q�l$d蛗��f�n�t$ �v s�d$(�l$,�t$0�@a�5(au��w�ֹ�|$0�t$ 3��_^��]��$�[d� �ĝ���að���������d$v����at v�����^�u��qsvw�e �� �e�d��d��e�] �c��m���_^[��xy�$��xy�$��u��qqsvwd��e��e�^@j�u �u��u�ɗ�e �@$��m �ad��]��d�_^[��u���svw��e�3�ppp�u��u�u�u �u�[�� �e_^[�e��]�u����e �e��m�e�e�e��^@@�m��e�d��e썅����d��uq�u�$�ȋe�d�����u����e jp�p�pj�u�p �u���� ]�u���4svw�e��eܦ_@�e�e��e �e�e�e�e �e�e��e��e��e��e�x_@�e�m�d��e؍�����d��e��e�eћe�eԍe�p�e�0�$�phyy�e��}�td���]؉d�� �e�d��e�_^[��u��svw��e�@��f��t�e �@$jx�mj�e �p�e �p�e �pj�u�e �p �u���� �e �x$u �u�u ������] �c�k �cjx_^[]�u��qsv�} w�}�w �_�ɖu�e�|9���u��mn��9l���};h~���u �e�m �e��u�} }ʋe��mf�1�m�;g w;�v����_^��[����u��svwujjh�`@�u�0�]_^[��]ël$�a�t�d$�t$���svw�d$pj�h�`@d�5d�%�d$ �x�p ���t.;t$$t(�4v� ��l$�h �|�uh�d��@�t���d��� _^[�3�d� �y�`@u�q �r 9qu��sq��"a� sq��"a�m�k�c�k y[�����������u��wv�u �m�}�����;�v;��x��u������r)��$��b@�ǻ��r ����$��a@�$��b@��$�lb@�b@,b@pb@#ъ��f�g�f���g������r���$��b@�i#ъ��f���g������r���$��b@�#ъ�f��g��r���$��b@�i�b@�b@�b@�b@�b@�b@�b@�b@�d��d��d��d��d��d��d���d���d��d��d���d���d���d�������$��b@���b@�b@�b@c@�e^_�ð���e^_�ð���f�g�e^_�íi���f�g�f�g�e^_�ð�t1��|9���u$������r ����$�pd@�����$� d@�i�ǻ��r �� ��$�xc@�$�pd@��c@�c@�c@�f#шgn��o��r�����$�pd@�i�f#шg�f���g������r�����$�pd@��f#шg�f�g�f���g�������z�������$�pd@�i$d@,d@4d@s�o<y�����t/p�@<;�yv��<8=uwsp��h�� ��t���ӌ�d8�3�_^[�s3�9�qau�d$��a|y��zt�� [�v�luawv�la9hua�=hatv��j� !yj[�t$���y�d$t j�q!y�v�׋d$_^[�u��q�=�qasvwu�e��a����z���� ��]�j;�^}��ja~ vs��jyy� ��ha�x#ƅ�u���e��ha�������dj�t�e j�e�] x� �e �]��vj�m�jqp�epw�5�qa�@h�� ��t�;�u�e�� �e��m��� �_^[��u���@v������wp�u�ta�����ub�paj^;�r��v'��t��t�l�����{��k� ����k�0�勅�����u -����#������������p� �f������p��f������p� �f �������f��������pv�#j����_^��u���@������vp�u�xa��ub�paj^;�r��v'��t��t�>k�����{�.k� ���!k�0�勅�����u -����#������������p�b�f������p�s�f������p�d�f �������f��������pv�zi��3�^���t$�|a��u�j�����3��u����e�8u�xtk�m�qp��a��t<�e�p�e�p��a��t*�e�j�p�e�p�e�p�e�p�e�p�e�p�mj���ã����u��v�uw� �9>t� �e�@ft�~to�}uij�v�u�u ����v�~ tp�8csm�u,9xv'�h�i��t�u$r�u �uv�u�u�u p�у� ��u �u�u$v�u�u�u p� �� jx_^]�u����e �e��@����e�|�m;a|��sv�u�csm�w� �9�k�~ub9~u]�~uw���xl�&���pl���@pjv�e�e��rjy��yu�w9���~u9~u �~u�y9���~��9~���}��e�p�e�pw�u �u��������؋e�;e���9;|;{w�c�e�c ���e�~d�f�@ �x����e�~�v�7�u�=�� ��u�m���9e���m�e�}���$�u��u$�u s�7�u�u�u�u�u v� ��,�}��e����i����}t jv�qyy_^[�à}u �u$�u �u��u�u�u�u v� �� ����u��qqvw�w�xht!�u$�u �u�u�u�u �u��������us�}�e�p�e�pw�u �u����������e�;e�so;>|c;~>�f �n����h��t�yu&j����u$�u vjp�u�u�u�u �u� ��,�e����_^��vw�|$ �g��tj�x�pta�t$�n;�t��qr�hy��yu"�t�t�d$��t�t �t �u3��jx_^�u��j�hah@�@d�pd�%�� svw�e�]�s�u�};utu���~;w|���e��g�d���t hsp�h�m����u��/yëe�m���}�]�u�g�4��u�릉s�m�d� _^[�ëd$��8csm�t3���/u��} s�]vw�} t�u sw�u����},�uuw��u,������u$�6�u�uw�����fh�u(@�g�s �u�uw�u���,��twp�o���_^[]�u��j�hah@�@d�pd�%��svw�e�]�]ԃe��u �f��e���@l�e���@p�e����}�xl���m�hp�e��e��u �us�uv�������eԃe��m���:�eԋm�d� _^[���u��nyëe�e�j��e�p�����yy3��ϋu �}�e؉f��u�m�hl�j�m��hp�?csm�u)�u#� �u�}�u�}�t�����pw��yyëd$��8csm�u�xu�x �u �xujx�3��u��j�h(ah@�@d�pd�%�� svw�e�m�a���u�x�k�a���`�u �| �e��td�uj�v�:eyy���0jw�deyy����f��m��qp�yy���u�tr�]j�s��dyy����jw��dyy�����v�sw� ����� �~���������v뗃~�]j�su:�dyy����jw�dyy��t~�v��v�s��yypw������� �f�\dyy��tvjw�jdyy��th�v�xdy��t;�tj�fp�s�yyp�vw�������fp�s�yyp�vw������ �m���m�d� _^[��jxëe��u��j�h8ah@�@d�pd�%qqsvw�e�e��t�h�i��t�e�q�p�r����m���m�d� _^[��3�8e ��ëe��d�l$v�t$��qƅ�| �42�i� ��^��������u���sq�e �� �e��eu�u�m�m��b���vw��_^��]�mu���u�q�@���]y[�� v�e��a�����"at:jtj�c��y��yt)v�5�"a��a��tv�y��a�n�j�x^�3�^ëd$�@ppfa�@�vw�pa�5�"a����a����u?jtj�lc��y��yt&v�5�"a��a��tv����y��a�n���j�����yw��a��_^�u��j�hhah@�@d�pd�%qqsvw�e�3��u��j���9p`t�e��y����p`�u�� jxëe�e��m�����cu��j�h`ah@�@d�pd�%qqsvw�e�e���"a��t�e����jxëe�e��m����i���v�t$j�&�$af�8mzu�h<��t ��h��@�f^�u��,�%g��h���spdžh������a��t��x���u��l���rjx�������h�ph�a��a����3ۍ�����8�����t�j,p�dy;�yt0@��8t�9;u��a8u�j sp�zb�� ��t��t��t�e�p�����}�y���[��3�j9d$h��p��a����fat6��������fau h��$y� ��u�^ ��u�5�fa��a3��jx�h@j�5�fa�xa����fauël$�%�fa�%�faj��fa� �fa��faxá�fa� ���fa� �;�s�t$ p ��r����3��u����msv�u �aw����� y ����i���d�m��i���m����1�1�u�v��u��u����] u~��j��?vj?z�k;kul�� s������l��!\�d� u(�m!�!�j����l��!���� u�m!y�m��] ��m��s�[m�z�u �m��z�r�s����j��?vj?z�]����]��� u��]���j?�u k^;�v��m��щm���j;�v��;�tc�m �q;qu@�� s��������!t�d�lu&�m!1��k������!����lu�m!q�m �q�i�n�m �q�i�n�u ��]�}�u;����m��\�� щ^�n�q�n�q�n;nu`�l�� �m���ls%�}u������m ������d�d �)�}u�j����m y�j���ꍄ�� �e���d0��e������fa����� �fa�5�a��h ��h@sq�֋ �fa��fa���� p��fa� �fa�@������fa�@�hc��fa�h�ycu �`���fa�x�uisj�p �֡�fa�pj�5�fa�pa��fa��fa�����ȡ�fa ȍl�q�hqp�����e�� � �fa;�fav�m��fa��fa�e�=�fa��fa_^[��u�����fa��fasv��w�<��e�}��h����m���i�� }�����m���u��������3���u�e���fa��;߉]s�k�;#m�#� �u ��;]��]r�;]�uy��;؉]s�k�;#m�#� �u����;�uy;]�s�{u���]��;]�u&��;؉]s �{u����;�u�8�؅ۉ]ts��y�k��c�8�u3����fa�c�����u�t�����|�d#m�#� �u7����pd#u�#u�e��hd ֋u�u����e�#u�����#9 �t�u���3�i���d�m�l�d#�u ����j #m�_��|��g���m�t�� m���m���n��?~j?^;�� �j;jua�� } ������m��|8�ӊ]�#\�d�\�d�u8�]�m�! �1�o����m��|8������!��]�u �]�m�!k��]�j�z�}��y�j�z�y���m�|�� �z�j�q�j�q�j;jud�l�� �m })���} �lu ������ ;������m� |�d�/���} �lu �n���� {�m������n���� 7�m���t � �l���m��u�эn� �l2��u��ɍy�>u;�fau�m�; �fau�%�fa�m���b_^[�á�fa� �favw3�;�u0�d�p��p�5�faw�5�fa�ta;�ta��fa��fa��fa� �fah�aj���5�fa�4��xa;ljft*jh hw��a;ljf u�vw�5�fa�pa3���n��>�~��fa�f����_^�u��q�msvw�q�a3ۅ�|��c����j?i�z��0d�e��@�@��ju��j��y hh�w��a��u������p;�w<�g�h����������@����������hǀ���h�;�vnje��o �j_�h�a�j �h�a�d�d�����fc�������e�ncu x��������!p��_^[��u��� �m�esvw�} �׍p q �a�������i���d�m�o�i;�m�\9��|9��]��_���o�;��e�m���i��?�m�vj?y�m��_;_uh�� s����m��l��!\�d� u �m!�$������m��l��!���� u�m!y�o�_�y�o��y�m �m��}����}��m ��o�l1���?vj?_�]���]�[�y�]�y�k�y�k�y;yu\�l�� �m���ls!�}u������m �d�d�����%�}u�o����m y�����o���� �u �m��d2���l���u �f�b��d2��g3��c�:�] )u�n�k��\3��u�] ��n�k���?vj?^�e����u���n��?vj?^�o;oug�� s������t��!\�d�u(�m!�!�n����l��!���� u�m!y�] �o�w�q�o�w�q�uu��u��n��?vj?^�m�|�� �{�k�y�k�y�k;ku\�l�� �m���ls!�}u������m 9�d�d�����%�}u�n����m y�����n���� �e��d�jx_^[�ã=�"a�suvwu��"a�h j�5�fa�xa����� �-�ajh h@j�ջ�����j�hsw�յ�����"a;�u�=�"au��"a�=�"au��"a����"a�f�5�"a�f�0��@����f�f�n �~�f3���3҃���j#�je��h����|�sjw�9�� �f�;�s�����g��g����܋��'h�jw��a���"atvj�5�fa�pa3�_^][�v�t$h�j�v��a95�bau�f��ba���"at �f�vj���n�h�5�fa�pa^ã �"a�^�u��qsv�5�"aw�~����e��� ��?�?�u9��h@fhp��a��t��� �oa�f ��t;�v�~ �e��mt ������}��}��΋vt,�y�u&j�a z�8�u b����|��uq����y;5�"at �}�p���_^[�ëd$��"av��;av;ar� ;�t7��u1�����;�r �t$ ��t$��f��� �� �^���d�3�^ëd$�l$ h�� �d��l$ ��!�8��@�u��oa�=�oa uj����y�u��qqsv�5�baw�v������~�� �� ƃ����� �;��e�s:��];�|9_vsqp��� ��uu�e��_���� ;��e�r���]�f�n�~�e�;��m�s3�;�|9_vsp�u��j�� ��u&�_�e���;}�r���]�6;5�bat�c����5�ba)�~�(��"a����t� u �?;�����_ �e���� ������� w�;�u�}�} ���e��8�t�e�j�� hpv�e���a;���j�u�v�*6�u��� �ҋ�~0�f�u������p�p������a����m�u։=�ba�� ;�s �9�t����;��#��g �e�f�_))f�l����4�4�����t)�h�y�t��ba��� ӊq��)p���3�_^[��u��q�m�usv�qw�9���;�}��lj]r!��;�s)q� �a�a��g����>t�ƍ4;�sc���u0j�x^�;ucf��;�sn;e�u�q� )u 9u ���}������ƍ4;ur��q;�s~�;esv���u@j�^x�;u%c@���;]s ��q� �a�q�1����6;�s)e 9u r4������맍;]s ‰�a� �a�a���fk��� ��3�_^[��u��q�us�] v� w�}�e��� g�� ;m�|�v�e ȉ�g��`se�e�4���;�ru�;�s �8u@��;�ub�e��;�w ;�v'���;�s3��38u@�<t��c� �c�c� m�e��e�_^[��v�5�a�5,ca���5ca���5 ca���5�ba��^�u��ev�<��ba�4��bau>wj�8��y��uj�����yj������>ywu ��a�>������yj� y_�6��a^]�u��e�4��ba��a]���vc20xc00u���svwu��] �e�@���e��e�e��e��c��s �{���ta� v�|�tevu�k�t�]^�] �t3x<�{s��������kvs�.������ vj�d��������c �t��{� v�4�롸���u�kj�s�������]�]_^[��]�u�l$�)�ap�ap�������]��5lpa�t$�yyã|$�w"�t$���yu9d$t�t$���yu�3��u��j�h�ah@�@d�pd�%�� svw��fa��uc�u;5�fa��j �'���y�e�v�{���y�e�m��� �e��tm�j �]���yã�uz�e��t�p����j^�u;5�baw.j �����y�e�����p�����y�e�m��� �e��u-v��uj �����yëe��ujx��$�pj�5�fa�xa�m�d� _^[�áhpa��t�t$�ѕ�ytjx�3�����u��wv�u �m�}�����;�v;��x��u������r)��$���@�ǻ��r ����$�а@�$�ȑ@��$�l�@���@ �@0�@#ъ��f�g�f���g������r���$���@�i#ъ��f���g������r���$���@�#ъ�f��g��r���$���@�i��@��@��@��@��@|�@t�@l�@�d��d��d��d��d��d��d���d���d��d��d���d���d���d�������$���@��ȑ@б@ܑ@�@�e^_�ð���e^_�ð���f�g�e^_�íi���f�g�f�g�e^_�ð�t1��|9���u$������r ����$�p�@�����$��@�i�ǻ��r �� ��$�x�@�$�p�@�h�@��@��@�f#шgn��o��r�����$�p�@�i�f#шg�f���g������r�����$�p�@��f#шg�f�g�f���g�������z�������$�p�@�i�@ �@�@�@$�@,�@4�@g�@�d��d��d��d��d��d��d��d��d� �d� �d��d��d��d������$�p�@��`�@h�@x�@��@�e^_�ð�f�g�e^_�íi�f�g�f�g�e^_�ð�f�g�f�g�f�g�e^_�á�favj��^u��;�}�ƣ�fajp�8(y��va��yu!jv�5�fa�(y��va��yuj�����y3ɸ�ca��va��� ��=0fa|�3ɺ�ca��������4��ua�������t��u� ��� a�� da|�^��q.�=�pat�8-ëd$��ca;�r=faw �����p�=���yã� p��aëd$��} ��p����yëd$�� p��aëd$��ca;�r=faw �����p�l���yã� p��aëd$��} ��p�-���yëd$�� p��a�v�t$�v�>.��ytw���cau3�� ���caucjx�ppaf�f ur�<�tpasw�<�tpa�u s������y�u�fj�f�x�f�f� �?�^�~�>�^f�n jx_[^�3�^ã|$vt �t$ �f tv�,�f �f�&�fy^�u���hsvw�} 3��g�ۉu�u�} ���m�3���m��u�3�9u����� |��x�ê��a���3�����a�����e����$�ݜ@�m���ủu؉u��u�u��u��x�ã� t;��t-��thht���y�m��p�m��g�m��>�m���5�m��,��*u#�ep����y�e���m��؉e���e��ˍ��da���u�����*u�ep���y�e����m�������ˍdaљe����it.��ht ��lt��w���m���m���m� ��?6u�4ugg�m���} �l�uћ �ha�u����da�t�e�p�u��p���� g�} �e�p�u��p�f�� �%�ã�g���e����x���x��c��hhtphhtl�� ��f�e�0u�m��u����u�����ep�f�e�y�ȉm�����u � 4fa�m��e�����n����f�8��@@���e��� �m�@������;ʉ}����e���f�e�0u�m�f�e��ept;�0p������p��*�� �e��}2�e��)��zt2�� t�h�����y�������e��������e����ep���yt3�h��t,�e�t���m��e��e���e��m����0fa�e�p�u ��gu�e��e�ũ��e�u��h��m��@��e���p������p�e�p�0la�u�����t�}�u������p��t��o���_^�s�\$ ��kvw��~&�|$�t$�wf�t$p�u����� �?�t��k���_^[ëd$���@�ëd$���a��q�ëd$��f�@��u�����e�sv�u 3�w��]����]��� �}��}3ۃ=�ja~��jp� yy�� �ha���a��;�t6�m�w�e�wp�% yyp� �ffp� (�� ��t�ffp��'y��>%���e��e��e��e��e��e�3��e��]�]��]��e��]��^f�=�ja~��jp�oyy�� �ha�êa����t�e��e����dcљe��e��n>t^��*t2��ftt��it ��lu7�e��e�~6u,�~4�fu#�eѓe��e����'�e��"��ht��lt ��wt�e���e��e���m��m��}��o����}��u u�e�e����e�@��eԁe��}�u��m��}��u�>%um�e �xnud������v����0�u�m��u���m�ws�yy��m�wp�}�m�ws�s���}��u�e̅�u 8e�u�����e�_^[�ã=�jav~�t$jv�yy��t$��ha�p����u��߃���^ët$�jx � �a� �r�yã|$�t�t$�t$�kyy�v�t$w�t$�������w��y��yu��_^���������̋l$��t�a��t@��u������~ѓ��3ƒ���t�a���t2��t$��t��t�͍a��l$ �ía��l$ �ía��l$ �ía��l$ ��u��sv�u �f �^�����@���t�f����n$���f �f �f�e $� f� �f u"���cat���cau s����yuv�!yf�f wtg�f�> ��h��ni���n~wps�l�� �e �6���t�ˋ������ ��ua�������fa�@ t jjs�y�� �f�m��j�e_wps��� �e 9} _t�n ��e%�� �f ���^[]á�va��t��h$ ah a��h ah a�����jj�t$ ��� �jj�t$ ��� �w�j_9=�pau�t$��ap��a�|$ s�\$�=�pa��pau<��va��t"� �vav�q�;�r���t�ѓ�;5�vas�^h0 ah( a�cyyh< ah4 a�2yy��[t�_��t$�=�pa�da_�j ����y�j � ���y�v�t$;t$ s ���t�ѓ���^�u��qsv�u������vp�u�&y��y��x�ۉ]���u �`jx�������nt�m��m �nt�h������fa� �fa�w;�}'� r���~p�� �d9��=�fa��fab�;�|�]��~x=��u �fx��^=��u �fx��n=��u �fx��>=��u �fx��.=��u �fx��=��u �fx��=��u�fx��vxj��y�~xy_��`q��y�e��ft���� �u ��a^[�ët$� �fav�t$92w��t���u�n@���u �n��n�c��|��5�va��a_^[�á�oa��t ��u*�=�"au!h����qay��t��h��y�u����u3ɸga;t ��a=�ga|�v����;�ga���oa������u �=�"a���������\���hpj�8a��u��\���hap�0yy��\���wp��\���� ���@y��u����;�y�d$t/wwupj��6wj�ӆ�tw�t$��f��y;�yu�3�_^][yã����u��j�h@ah@�@d�pd�%��svw�e�3�9=�qaufwwj[sh<a�vw�a��t��qa�"wwsh8avw��a���"��qa9}~�u�u�yy�e��qa��u�u�u�u�u�u �u��a������9} u��qa�e ww�u�u�e$�����@p�u ��a�؉]�;����}����$��h �e�ĉe܃m���jxëe�3��}܃m���]�9}�tfs�u��u�uj�u ��a��tmwws�u��u �u�a���u�;�t2�e t@9}��;u�u�us�u��u �u�a����3��eȋm�d� _^[���e��6��$�� �e�܉]��m���jxëe�3�3ۃm���u�;�t�vs�u��u��u �u�a��t�9}wwuww��u�uvsh �u �a��;��q������l����t$�d$��v�j�t �8t@��i��u�8^u d$ë��u��q�e�h��w � �ha�a�r��v�5�ha�����dv�^t�e��m��e�j� �e��e�jx�m jjjqp�e�pj�����u���e #e ��������w�|$�j��$���l$w��t�a��t;��u�����~ѓ��3ƒ���t�a���t#��t��t��t�͍y�� �y���y���y��l$ ��t�a��td�g��u���������~�ѓ��3‹����t��t4��t'���t���t�lj�d$_�f��d$�g_�f��d$_è�d$_�v�v�l$3����ja;t"��f=(la|��r"��$w�b� ^��5� ��ja^�á��r���w ��^���^�蛾�����蒾���� �u���$s�]��l��f�������vw�} �4�4nau��u��~f� �ík�i�m���։u�щ]�‹u� @�e�e� �k�<mk�< pmao�} �}�_^����u|�mt �} �u �=tmat�e�p�yy�m��t xma������[��v�t$��8csm�u�xu�x �u������qa��tp�j��yt v��qa�3�^�hǻ@�a��qa��5�qa�a�vj^�t$ �t$ �a��t3���^�vj^�t$ �t$ �ha��t3���^�vj^�t$� a��t3���^�����̋t$�l$��u<�:u. �t&:au% �t��:au �t:au���� �uҋ�3�ð���@ë���t�b:u�a �t���t�f���:u� �t�:au� �t����u��j�hxah@�@d�pd�%��svw�u�u �u �u���w3�;�uj^������u �3ۉ]��������fa��ua�}�;=�faw|j �i���y�]�w����y�e��m���9]�t^�u��h3ۋu j �}���yã�ua;5�baw9j ����y�e�����p�����y�e��m���l9]�tvs�u��w�� 9]�u>vj�5�fa�xa�e�9]�u'9lpatv�<���y���0����3ۋu j �����yëe��m�d� _^[��j ����j��yyj�����j�t$�t$�t$����u��� s�e�vw�}��w�u��=�ja~��jp�z���yy�� �ha�êa����t�f�ѐ�-�u�u�m��� u�f�u��e����������$�wj��yu$��0t �e �2���t �}��w ��u,9u�v'������e�"t�m����e$�����ɖe���t�e���et�e��؉e��e�� �e ��t�83�_^[�������������̍b�[í�$�d$3��d$s�����t$��t� b8�tф�tq��u� �w����v ؋ ����~����3���������3�3ƃ����u%�t�%u���u�^_[3�ëb�8�t6��t�8�t'��t���8�t��t�8�t��t��^_�b�[íb�^_[íb�^_[íb�^_[����̋l$wsv��|$��ti�q��to���l$�f8�t��t �f8�t ��u�^[_3�êf8�u�~��a��t(���8�uċa��t�f���8�t��3�^[_��������g�^[_ë�^[_�u��wvs�m�&�ً}��3����ˋ��u �f�3�:g�wtii�ы�[^_����������q=�l$r��-�=s� ȋą���@p�̋t$ �l$��tg3��d$w����r-�ك�t шgiu������������ʃ���t��t�gju��d$_ëd$�swj3�����yj_9=�fa~]v��va�������ta�@ �t p�b���ytc��|)��va��� p��a��va�4�آ����vay�$g;=�fa|�^j����y��_[�v�t$v�#��yt���^��f @t�v�p��y^��3�^�sv�t$ 3�w�f �ȃ���u7f�t1�f�> ���~&wp�v��� ;�u�f ��t$��f ��n ����f�f�_��^[�j�y�svwj3�3�����3�y95�fa~t��va����t_�@ �typv������vayy���h ���t0�|$up�������ytc��|$u��tp�������yu ���va�4�v����yyf;5�fa|�j������|$y��t��_^[ëd$;�var3�ëȃ������ ��ua�d���@�u��sv�luawv�la�=ha3�9huatv��j����yj[�u �u�y�e ��yt j�]���y�v�׋e _^[]�u��e��u]ã=�qauf�m f���w9j�x]ím�eqj�5�jap�e jph �5�qa�a��t�}t������*���]������sv�d$ �u�l$�d$3���؋d$ ����a�ȋ\$�t$�d$ �������� �u�����d$�ȋd$���r;t$wr;d$ vn3ҋ�^[���������s�d$ �u�l$�d$ 3���d$���3��p�ȋ\$�t$ �d$�������� �u�����d$��d$�r;t$ wr;d$v d$t$ d$t$ ���؃�[�u��sv�luawv�la�=ha3�9huatv��j�o���yj[�u�u �u��� �e��t j����y�v�׋e_^[]�u��sv�u 3�;�t9]t�:�u�e;�tf�3�^[]�9�qau�m;�tf��f�jx�� �ha���da�tn��ja��~*9e|/3�9]��q�upvj �5�qa��a����jau�9er8^u�������*����3�9]��p�ujvj �5�qa��a���x����ƀ=�ja~j�t$����yyëd$� �ha�a���������������̋d$�l$ ȋl$ u �d$���s��؋d$�d$؋d$���[������������̀�@s�� s����ë�3������3�3��v�t$�f �����@���t �f � f� �f u v��y��f��v�v�v���� �f��to���tj�v �‚u7�nw���t�������<��ua� ɍ<����fa�o_�ႀ��u�� �v �~u�n ��t ��u�f�h�f�a�^�������� f �f���^�s�\$���vta�t$�f �u��t2�u.�~uv� y�;fu �~u@��f @t��8t@����^[�����f �f$� �f ��%���v�t$;5�vas@�΋������ ��ua���d�t%wv���t$�t$v�(v�������_^��x���� �v���� ���^�v�t$wv�k���yu �n���� �-�t$j�t$p�a�����u�pa�3���t p����y�����΃����ƌ ��ua���d���d���_^�v�t$;5�vas@�΋������ ��ua���d�t%wv���t$�t$v�(v���@����_^������ ����� ���^�u���svw3�9}�}��}�u3��f�e�����ua�e���4�����d0 tjw�u������� ���@����e 9}�e��}���������m� m ;ms)�m��e�� �� u�e�� @�@�ȍ����� ʁ�|̋������� ��e�jp������wp��40��a��tc�e�e�;�| �e� e ;er�3��e�;���9}tbj^9uul����� �����0�a�pa�e�ǎm�wq�u�u �0��a��t �e�}�e���pa�e��u�����y����,��d0@t �e �8���������������8�� e�_^[���ppah����y�l$���at �i �a��i �a�a�a�a�a��u���svwj�{����u���y;lsay�]u3��p���v3ҹxla9tt��0b=hma|�e�ps�aj^;��!j@�%duay3��`ta9u�󫪉lsa���}����m������a���;�����ata@��e�j@y3��`ta�4r������hla�;��t,�q��t%���;�w�u���pla�ata@;�v�aa�9u��e����}�r��e�\sap�lsa����\la�psa��y�dua��raa�y��g����ƀ�ata@=�r�s�y�dua�5\sa��%\sa3��psa�����=�qat���������j�g���y��_^[�ëd$�%�qa���u��qa�%a���u��qa�%a���u��qa��qaëd$-�t"��t�� t ht3�øøøø�wj@y3��`ta�3��psa�lsa�\sa�dua���_�u����e�vp�5lsa�a���3��������@;�r�e�ƅ���� ��t7sw�u�� ��;�w ȍ�����a� �����˃��bb�b���u�_[j�������5dua�5lsap������vpj��j�������5lsavp������vpv�5dua�{���j�������5lsavp������vph�5dua�s�����\3�������f���t��ata��������`sa���t��ata �������〠`sa@aa;�r��i3����ar��zw��ata�ȁ� ��`sa���ar��zw��ata �ȁ� ����`sa@;�r�^�ã=�vauj�����y��va�s3�9�qavwubh�a�@a��;�tg�5dah�aw�օ���qatph�aw��hpaw��qa�֣�qa��qa��t�ћ؅�t��qa��ts�ћ��t$�t$�t$s��qa_^[�3����������������̋l$ w��tzvs�ًt$���|$u��uo�!�f�git%��t)��u����uq��t �f�g��t/ku�d$[^_���t�gi����u����ul�gku�[^�d$_é��it�����~�ѓ��3‹����tބ�t,��t���t ���uɖ������������3҉��3�it 3����iu���u��d$[^_�u��j�h�ah@�@d�pd�%��0svw�e�3�9�qaj_u@w�<apwpss�$a��t�=�qa�#w�8apwpss� a�����qa�u;�~v�u����yy���u9]~�u�u����yy�e��qa��u�u�uv�u�u �u� a�;���9] u��qa�e ;�t 9]��;uujx�x9}~���l;�a�e�p�u �a���q;�~,�}�r"�e�8]�t�p:�t�m� :r:�v�@@8u�j�9]~1�}�r��e�8]�t��p:�t��m� :r:��x���@@8u��z���ssv�uj �u ��a�e�;����]����$������e�ĉe܃m���jxëe�3ۉ]܃m���uj_9]����u��u�v�uw�u �5�a�օ�tyss�u�uj �u �֋��u�;�ta�}��6��$��:����e���}؃m���jxëe�3�3��m���u�;�t-vw�u�uj�u ��a��tvw�u��u��u �u�$a�3��e��m�d� _^[��u��qqsvw3�9}tuj=�u�t��y;�y�u�t@9ut;�|pa3�8^��;�pau p�y�|pa;�ut9} t9=�pat������t>���_^[��;�� j�b���;�y�|pat߉89=�pauj�g���;�y��patĉ8 u�=|pa�}�v�u����y��y|c�?t>��t2�4��<����y�?t �gf���������p�u�跑��y��yt<�5�e���2��uz��}�ލ�pw菑��y��y�@����m� ��d��|pa�} tf�u����@@p蓺����y��yt.�uv�������y eye�� @�����#�sv�(av����y3������v�5|paw���t-�|$wp�t$�:����� ��u ��8<=t��t�f����u׋� |pa����_^ë� |pa����w�|$3ʌ�u3�_ã?�gt �a����u�su��vp�͹����y����uj �n���y��߅�tp������y����&��^][_����������������u��v3�pppppppp�u �i� �tb�$��u����a� �tf�$s���� ^����u��v3�pppppppp�u �i� �tb�$��u� �t f�$s�f��� ^��u��j�h�ah@�@d�pd�%��svw�e�xra3�;�u>�e�pj^vh<av�0a��t����e�pvh8avs�,a����jx�xra��u$�e;�u��qa�u�u�u �up�,a�����9]u��qa�ess�u�u �e �����@p�u��a�e�;�tc�]��<�ǃ�$��"����e��u�wsv�b����� � jxëe�3�3��m��;�t)�u�v�u�u j�u��a;�t�upv�u�0a�3��e̋m�d� _^[�ã=sau$j �]����=sayu ��saj 袶��y�u��qqsvwj _3�w�]��)���� �ma�� �ma��`ra�$a�;�����y;���w�y����$hra�4a����%�hra� �rak��4�sa;�tpv����y��y��5sa����v����@p������ ;ãsa��vp����w� ���jv�5�ma������ma�����`�>-u�e�fv�� y�0��i�� pma�< t:�|<9f��>:unfv�� k�:u#fv� y� pmaȉ pma�:�|<9f��}�t�ى pma����tmatjv�5�ma�������ma�� �`���ma� �w����y_^[��vj 谳���t$ �j ��������� ��^�svw3�9=tmau3��l�t$j[�f;�mau ;�ma�9=`ra��� saqf9=sa� saq� saq� saqu� sawq� saq� saqps�� saqw� sawqpws���ra��,f9=�rap��rap��rap��rapu(��rawp��rap��rap�vsw���,�b��rapw��rawp�vw��wwwjwwsjpss�wwwjwwjj �vsw�{��x��ma��ma�n;�};������;������;�~;�}��_^[�;�|�;��;�~;�������fk�<fk�<i��;�u3�;�ma������3�;na����u��} s�]v���e�]�e��u ����na� ����4na�ӎhi�m�c�w����j���:%���_����e_;uk� �e�l�� k� �eȃ}u8�}u��na���8na;�~ ����e��u � �na�� �4nam �}u �e$� �mak�<e(��mak�<e,i��e0��ma�u�e$� �mak�<e(k�<xmae,i��e0�nay \&i�na��\&;�| �a�na� �ma��ma^[]�u��� �e�e�hsvhwtghhtf��ta��t<��t*��tht����f�$sa�$sa�b� sa� sa�5�(sa�(sa�(�������vp�u���y��y���sa�saj�e������uy��u�}���s�_���y��3�;�u9m�tj�g���yj�o����e��t �� t��u�vt���u��ntui�vx�fx��u��u7� �fa��fa�;�}(�i���vp�� �d���fa�=�faa�;�|����}�tj�ǯ��y�}u �vxj��yy��u�ӄ} yt�}u�e��}�ftu�e�fx3�_^[�ët$� �fav�t$9rw��t��t$�l$ v����b ����p��q�����q����p�q����p���;�r�^_� ��������d$v��wj�~dwp������8����?��8r�x �qh`oa���3�l$jq���%�d$$��u�d$�vljrp���k���_^������s�ًl$ u�sdv�4����ʃ�?;�w�sds�ch�{h�ѽ@�� ��;͉{hrr�t$�͍|�����ȃ��kq���|������u?�l$;�s�t$�ˍd2�p�_�����@��@;�r�l$3��3��t$ ύ4�|�����ȃ��_^][�����������m��"���m���%���m���e���@a�/h���������������̍m��(a���m�� a���m��a���m��e���xa��g�������̍m���@���m���@����a��g�������̍m��h'���m��@'����a�g�������̋m��#���m�� '��� a�g�������̋m��(e���h a�g���������������̍m���*���m���;���m��h@���m��`@���m���d���m���d���m��h@���m��"���m���d���m��$���m��(@���m��d���m��@���m��d���m��x$���m��@���p a��f�������̍m��x$���m��02���m���?���m���?���m���?���m���?���m��?���m��?���m��?���m��?���m��?���m��?���m��?���m��?���m��x?���m��p?���m��h?���m��`?���m���c���m���c���m���c���m��@?���m��8?���m��!���m��c���m��#��� a�f�������̋m��c���m��?��� a��e�������̋m�����8 a��e���������������̍m���>���m���>���m��hc���m�@c���m�>���` a�e���������������̍m��� ���� a�oe���������������̍m��h>���m��`>���m��b���m�p>���� a�7e�������̋m��b���m�0>��� a�e�������̋m�b���m�>���@ a��d�������̋m��h"���m�����=���p a��d����̋�������=����������=�����������=���������ab���������=��������� b��������� b���������=���������z=����������a����������a���� a�kd�����������̋eѓ�����m�:=��ím��1=���m��a���m��!=���m��a���m��a���m��a���m��a��� a��c��������̍m��xa���m���<���m���<���m��`a���m��<���m��pa���eă�����m�<��ím��1a���� a�c��������̍m��<���m��<���m��x<���m��a���m���@���m���@���m��x<���m���@���m���@���m�@<���e�������m�*<��ím��@���� a�c��������̍�h����<���m���;����\�����;����t����w@����t�����;���m���;���m���;���m���;���m��;���m��;���m��;����\����1@����h����&@����x���������m�};��í�h����@����\�����?����h�����?���ha�bb��̍�t����e;����������?����h����/;���������$;���������;���������;����x����;����x����?����h����}?����t����r?����h����g?����t����\?���a�a���̍m�:��������������m�:��ím�&?���m�?���������?���������?���m�?���m��>���m��>���m��>����a�?a���������������̍������5:���������*:���������:���������:��������� :���������>���������>����������9����������9���������b>���������w>��������������m�9��í������2>���������'>���a�~`��������������̋m��>���m��p9����a�w`�������̍m��x9���m��p9���m��h9���m��@9���m���=���m���=���m��=���m��=����a�`�������̍m��9���m��9���m���8���m��=���8a��_�������̍m��h=���m���8���m���8���m�p=���m�8���xa�_���������������̋m�(=���m�8����a�w_�������̋m�=���m�p8����a�w_�������̋m��<���m�p8��� a�7_�������̋m��<���m�08���pa�_�������̋m��<���m��8����a��^�������̋������<����������7����a��^���������^����a�^��^pr��&6jxdr�������� *8f^v������� &4n^lz������  4pj������� 0n^n��������2����p@�@p@�@0@p@`@p@`@@�@p@�@�@p@�@�@*@�@�,@07@`@p@`@�]@����:e@�����e@����gg@�����h@�����j@�j@����~s@�s@���� u@�t@�t@����cw@gw@�����w@�w@����vy@by@fy@�����y@�y@�y@__global_heap_selected__msvcrt_heap_select������@�����@eee50p (8px700wp `h````ppxxxx(null)(null)runtime error tloss error sing error domain error r6028 - unable to initialize heap r6027 - not enough space for lowio initialization r6026 - not enough space for stdio initialization r6025 - pure virtual function call r6024 - not enough space for _onexit/atexit table r6019 - unable to open console device r6018 - unexpected heap error r6017 - unexpected multithread lock error r6016 - not enough space for thread data abnormal program termination r6009 - not enough space for environment r6008 - not enough space for arguments r6002 - floating point not loaded microsoft visual c runtime library runtime error! program: ...������@���� �@����ֶ@ڶ@������@��@������@����!�@getlastactivepopupgetactivewindowmessageboxauser32.dll����u�@y�@������@��@�����@�@sunmontuewedthufrisatjanfebmaraprmayjunjulaugsepoctnovdectzh:mm:ssdddd, mmmm dd, yyyym/d/yypmamdecembernovemberoctoberseptemberaugustjulyjuneaprilmarchfebruaryjanuarydecnovoctsepaugjuljunmayaprmarfebjansaturdayfridaythursdaywednesdaytuesdaymondaysundaysatfrithuwedtuemonsun�,@ �`a������@������@�@ ��a���� �@����(�@����0�@����8�@ ��a����p�@����x�@ � a����p�@����x�@ �8 a������@������@ �h a������@ �� a������@��@��@��@��@��@�@�@�@�@ �@ (�@����0�@����8�@@�@h�@ �0 a����`�@����h�@p�@x�@��@��@��@��@��@��@��@ ��@��@��@ ��@��@��@��@��@��@��@�@�@�@�@ �@����(�@ �( a����@�@����h�@ �x a����`�@ �� a������@������@��@��@��@ �� a������@ �� a������@������@��@��@ �0 a�����@�����@ �` a����0�@����8�@ �� a����p�@x�@ � � a����p�@����{�@��@��@��@��@��@��@��@��@��@ � 8 a�����@�@�@'�@/�@7�@?�@g�@ �� a������@`�@h�@p�@x�@��@��@��@ � a�����@��@��@��@��@��@��@��@��@�@�@'�@ ��a������@@�@k�@s�@s�@^�@i�@t�@|�@��@��@��@��@��@��@��@��@��@ � 8a�����@ �@�@!�@,�@7�@b�@b�@n�@����y�@m�@x�@����c�@ � �a������@��@��@��@��@��@��@��@��@��@ �8a������@�@�@&�@1�@<�@g�@r�@]�@h�@ s�@~�@��@��@ ��a������@������@ ��a������@��@�@�@�@�@ �@(�@ �xa����@�@����h�@p�@x�@ ��a����p�@����x�@������@��@��@ ��a������@������@ �a������@������@ �@a������@������@ �pa�����@�����@ ��a����0�@����8�@ ��a����p�@����[�@ �a����p�@tbd�^pr��&6jxdr�������� *8f^v������� &4n^lz������  4pj������� 0n^n��������2�����freelibrary>getprocaddress�loadlibrarya�multibytetowidechar�widechartomultibyte�lockresource�loadresource�sizeofresource�findresourcea&getmodulehandleaclosehandlereadfilegetfilesize4createfilea$getmodulefilenamea�getcurrentdirectorya�unmapviewoffile�mapviewoffile5createfilemappinga/rtlunwind�heapfree�heaprealloc�heapalloc�getcommandlineatgetversion}exitprocess�interlockeddecrement�interlockedincrementgetlasterror�findfirstfilea�findnextfilea�findclose�filetimetosystemtime�filetimetolocalfiletime�getcurrentthreadid�tlssetvalue�tlsallocqsetlasterror�tlsgetvalue getenvironmentvariableaugetversionexa�heapdestroy�heapcreate�virtualfree�virtualalloc�isbadwriteptr�initializecriticalsectionudeletecriticalsectionfentercriticalsection�leavecriticalsection�terminateprocess�getcurrentprocess�unhandledexceptionfilter�freeenvironmentstringsa�freeenvironmentstringswgetenvironmentstringsgetenvironmentstringswmsethandlecountrgetstdhandlegetfiletypepgetstartupinfoa�writefile�heapsize�lcmapstringa�lcmapstringw�setunhandledexceptionfilter�isbadreadptr�isbadcodeptrjsetfilepointer�getcpinfo�getacp1getoemcp!comparestringa"comparestringwbsetenvironmentvariableasgetstringtypeavgetstringtypewpgettimezoneinformation�flushfilebuffers|setstdhandlekernel32.dll[regclosekey{regqueryvalueexarregopenkeyexaadvapi32.dll03@�3@�k@��@ �@ �@m�@�@jni_createjavavmjava.vm.versiongetproperty(ljava/lang/string;)ljava/lang/string;java/lang/systemjava/lang/stringmain([ljava/lang/string;)v%s %dserialmainclass%d.%dminjre-dapplication.home=-dj2e.app.path=-djava.class.path=-dpropertyoption .config.cfg\software\ibm\java2 runtime environmentsoftware\javasoft\java runtime environmentjvmdllcsiejre_order\jvm.dll...*.*jvm.dll..\jre\bin\jre\bin\bin\java_homejre_homeruntimelibcurrentversion;class_pathclasspathclasspath �q�@ǻ@�����x@�"a�"a�"a�"a�����������"a��oapa0papa�va�va,aa - ]]� �����������������x ���� �aha <a a�a�a�ala4a a�a�ataxdaytazda�l!a�4accc�ha�ha ((((( h���������������������� .        ! 5a cpr s wy l m pr � � � �� �)� �� � ���  �@�@�@�@�@�@�`�y�!��������@~�����ڣ ��@����ڣ ��a��ϣ���[��@~��qq�^� _�j�2������1~���p����pstpdt\ma�ma������������;zx����0nm����:yw����/mlpna8a4a0a,a(a$a aaaa�a�a�a�a�a�a�a�a�a�a�a�a�a�a�a�a�a�a�a�a�a�axapada\apada@a<a4a aa. oa8sa8sa8sa8sa8sa8sa8sa8sa8sa(oa�0������� ������0�h�`�x� ��������     0 @ p ` p �� �� � ��rh�hy��0|(�x}�������h���%�����`�h���d� �l�x�f�����$���(0`��������������������������3333333��������30;��������3330?����3333330?��3?�����333?3������3330?���30333?�?���33?���3330�3303330303�33333��333333��33��0ffff@33;�0uvfufd30��wx�ufffd3�0ww�h�uffep303w-f��fvevd3w������evff@3w-"'���n�fgp30w��""w���vwu0�-"""�~��"ewup3���""�����"&wwp3��~�������""wv`30����������""efe0���~������""�ve0���������-"-"vv0���~����"��"vv0�ڪ������"-""�f0zz������"�r.�f0���������-"'�f3���������""~vv3��ގ�������~vp;����������p;���������ꪪ��p;1������~���چ�1�������窪��p;�����~��w�ڨp�����}����}���1�}������wp?�1������������������81����؁3�����������������������?������������������?�����������������?�����������������������������?�?�?�?�?�?�?�?�?�?�?����������������������������������( @��������������������������3330;�����3?��3333;�;���33?�3033��300303;�330;�0;�ufep0�0��uvf`33��wefu0�-���ufp0��(���xx-".��"e�������"%�p0�ގ���"vvp0m������e`0m�����-"u`0h�ߏ��҂u`0��~���"�fp3j��ꨆp��������v���菈�چ 1n����ݧ��1������f����`?�mfm�?1�������������������������������?�?��������������?��?������( ���������������������������3333�33030;00�f`3�}0��ҁ0���`0��րs���гn��`��� 1vg3����?��3�����3�����0�(0`����������������������������������ޫ������ߩ�ܠ�����ݙ���ԙ���ύ�ӄ�܅�ڊ�ފ��r��w��}j݉�ه��s��p��wk�|ຆ��c[�z��sl�v��h�j��z��a��x��q��cb�km�bm�g��x7�h�\۽h��a��i�qm�\0�_��>v�u��f��6��= �u��.��>ײ2�,пuߣg�d��<��)'�l��5p�bܞa��e&�e��m��(ϫ$���6ܚ<�>ԗ<�&��ƒf��&��'�-q�.��,��o|�"�4��hޝ�� �$ȗ&a�%�t`<�(�����ԓ��.�$�py�y]ގt��%��� �� ш�mp��g��k� а�|(�}-��ކ�hn܍�ev��ft�w1�dk��{� ��fff�|��bd�w�s ��h5�`l�m$�|�ff�v�x�6��[a�_a�|�vw��[<�s|��c=j��y9zb<�nlf5���u�v4�j%��d_f/�t0�h�`�s�z&i~vf*�e�[*vsib%��aat/}��n*ef"%|mmmuv,�^�l&dn?d^tc}e�c6ft �x�i"�o=o w/e,gw�g%f�j�qneb�jlspef�lon�ner p\he�?�f�b�a�>�; 9b5!�7�7�3g-�-x*����������������}}iii\\vxxg��piiw�ddxg�������������vip�xxd���������������pii}�̎�w���~~~~~~u�������pi\��̎`������������~um������j\\���̔������������������u�����j\v����v������૮������ɹ����u����wvvk���i������������������ɴ�������wvlz����i����������������������ϲ������wllj���i�������������������������θ�����wlda]�v���������������������������ϲ�����jaa>������������������������������ٍ����ja>9d�����������������������������➍����j>990�����������������������������ͮ�����0900x����������������������������ѱ������000--����������������������������翰�����a----j����������������������������ʿ������a-'''���������������ƴ������������ʿ�������-''";������������ĭ���������������ʸ�������'"""������������������������������ʸ������,""7������������������������������������ηj����������zzz������������������������j����zsxsqqqszz����������������������� yytnn^i\\\iqqsz����������������������c1ffyyygdddvv\qsz����������������������w 3rmmm?0009av\ssz����ȼ���������������) �l�r�x9qf8q��j �x0�_"j�ef2�j�[%�l�eq�t4.��u �fpwtf*1���\d`)�o*��`ru�l��o(evmmm,x\o�[7f�p�c{�kt�h *f�v�t7lvcw[e�u�so�mf #c �m ezc0�c�ja]`qf$bg�f�c�< �@ �>g7#�8�6�6�6�2 s0�3b/ ��������������������������������������������������������������������|tbyv�������������������������kkp����nss�������υ������������tkυ����]��ŵ�������υ����������ggυ��ρ���������w���υ��������g_υ�ς����ͥ���ǵ����υ�������_r��ϋ�������������ǰ���υ������gr������������������ǰ��υ�����:gb�������������������ٴ��υ�����bbu�����������������������υ����a??�����������������������υ����:4/�������������������±���υ���j///�������������������±��υ���nj''~�������ⱦ����������±�υ���b�."'����������������������υ�����~ .���������������������υ������.[��z�}xxyy�����������υ���o��|lmmdrr_kxy����������υ���s���wulk7*4g_xy���������υ��������$3=8*b_x���������υ����g��mu ,11*gxy�������υ�����n�{uk8 %"bgy������υ������`mu=8% 4_������ʢυ������zto=,%%8@^{����̛υ��������cpfc6%=kiy�����]υ���������hv,7 8kf}����\υd����������hmm> qi����yυ�d9����������sg@i#)&3 h�g�]υ��d9������������jhaxheye-"qrυ���d9��������������eeese<<<��2;5((0n9��������������������������jdjz!����������������������?��������������������3�s����� ���( �5�6�<�=�=�a�f�g�k�p�r�w�z�a�b�dg�hi�ik&lmq9swujza{�{*}~)��ȃ�?��`������������s�m\�g�t�6��f�8�� �: �= м ���<�om\��p��e;b��ɖ}r1f���dae����!�}#\�#��#�k$�g%�%͉&�c(�l(�r(�f)o�)�x*ɂ,�a0wg1�^3�u5lf6��:��;�_a��b�_c��f�bg̙i$�i�cjmmmr�p��u��v��x��x,�y�z˜[m�[�s]�^��^��_��anbfff=�l��m��qv�uٴy�{}�|���ȁ�ãwن�ɇ�݊�ދ�������ו���ܦ�����������������������ffff�����������nommnfffff������du�fmyb`wrff����hpf:56>09l^ef���_v23zpf��sa  uex���si$ ?[qf��.y/ ',"cbf��.t=81*(!-;f��ag�ogh]4&#ff��at}��z�])%sf���dw����k@"jf����i\����l7 af�c����jj����>^<%u=fm @@@����ux; p1 ci- wzk��dޞd�i�]�fb�i-�h,�o3~q4bs8du=*yc!`@u3k-c( 3 3 3 3 3 6 <i$9 @@u9q3 <�\�ն��� ��� �������������ڕ1�m(�he�l1�n3�p3ir4nq1?l, @d( g �d ��h ��j ��f ��a ��;��:��3��-�j' �k �8 �9 �; �= e? ab$#@ 33������� �ȃ�u5�n3uu9m$@@u9 \3 m28j- gr0 ��x"��:��s��j ��k1��nl��ml��ll��ll��mo��mp��pu��ji��m��8 �� �e# �= �8 �9 �= `=! 6@ @ ո��� �����p �g-�s4jq6�@m3 x5 m2 bv3 ~�v ��/��y��l*��fe��dj��ch��fr��dn��ch��dj��fl��fl��ho��lu��p[��t`��ef��e��'�c! �= �9 �; y>! fb!m �!��������h"�d)�k.nq:b; p3#j0 osf ��x����m��\;��y:��v5��t2��[;��bg��r0��r/��s0��v5��y9��[=��_b��di��fl��jr��pz��`?��9��%�l �7 �9 �< qb#3 �'��������y)�>#�h,\s7%w6 &l1 t�^���#��z��v1��n*��m'��j$��i"��g��`8��c;��f��e��g��i"��j$��l&��n)��s0��y9��^a��dj��gm��nx��x0�� �[ �7 �9 �< u<"3 �,������!�lj1�=#�j.yv9gp5 v�v�����p��k%��g��a��>��<��9 ��8��j�ff2��7��5��7��9 ��; ��=��a��g��k%��m(��t2��[<��ch��gm��^5��3 �j!�7 �9 �= o># i$ڔ/���!���%�ԗ:�`<�j.�q4{�q�����a��a��=��8��4��3��3��3��3��a �gf#�ol��3��3��3��3��3��3��7��<��a��i"��l&��r/��[<��dj��d9��0�j!�7 �9 �? a=$ @֓4���&���*��c��^(�d(̏y�����_ ��; ��4��3��3��3��4��6��8��9��b�)f�.f�cq ��:��8��6��5��3��3��3��4��9 ��a��i"��m'��v5��_b��_a��-�v �7 �: r@ 0; β9��� ���/���4�ȑ@�}^<���"��t��4��3��3��5��8��;��=��?��a��a��c�f �f �d �cr��a��@��>��;��9��6��3��3��3��9 ��b��k%��q-��bq��_o��)�g �8 �= xd"  �a0�d���5���9���=�ƀ����3��3��5��:��=��@��b��e��g��i��j��l�e�f�f�e��j��g��e��b��@��>��:��6��3��3��4��=��h ��co��f^��wa�|$�7 �: �? 9d"�g���9���>���c���.��a��4��9��>��a��c��h��k��n��p��p��q��s�f�h�h�f�p\��p��o��l��i��e��a��?��:��5��3��3��h��fg��fr��f\��a�^! �8 �; [<"  ןh���?���c���g���l��b��<��@��c��i��m��p��r��u��x��y��[��]� m�o�o�m�k�g��v��r��p��n��j��e��a��=��8��3�v\,�f?��fg��fp��]h��'�7 �9 �@" 4@ �s ��s���i���m���q��8��a��g��m��p��t��w��[��^��_��b��b�dm�u�u�t�s�r�p��a��\��x��t��p��n��h��b��@��:�lx �jf4�yf<��fe��fp��b �z! �9 �<" l=$ ݧv���n���r���v���z��s��o��s��w��\��_��b��e��f��f��f�|�|�z�z�y�w�u�=o��b��_��]��x��s��o��k��e��@�ls�vf*�if4�yf<��fg��s)��*�7 �;! c>! ’k���w���w���[���_��b��v��[��_��c��f��f��g��i��k�rz����������}�{�w��f��f��c��_��\��v��p��m��h�0d�@f �vf*�jf4�f?��ca��5�> �=! }e% 0m3 �q|��5���[���`���e���i��e ��a��e��f��h��k��m��o��r��y�����������z}��t��m��k��i��f��e��a��^��w��p��s�f �-f�af �xf �mf6��fa��b�y$ �># �b% >i7�}�����^���e���j���n���l��f��f��j��n��r��u��w��z��|���������l���z��x��u��r��n��k��g��j�p�l�g�f�f�f �-f�bf!�\f-�qf8��v!�k) �=! �@# hk-ӄ����|(���j���o���s���w��k��l��q��t��y��|��~�y�����n����4������������}��z��v��q��q�x�u�q�n�i�f�f�f�0f�hf$�af0��[(��0�; �<" lc( ׇ��t��v���g���t���x���}��y��r��w��|�ҁ����g����ќ���������������������}��x��z�~�z�u�q�l�g�f�f�$f�8f�no�z]'��3 �8 �;! n@ ׇ��s��[��u���y���}��́��φ��*�р������f��������õ�<� �l��ה����������������������}����z�u�p�l�f�f�f � f�is�ib%��7 �8 �;! n@ ׇ��m��_��f��m��͂��φ��њ��ћ�=�� � � ��ϋ�������r���� �����������������������������~�q����~�y�t�p�k�f�b�(b �1f�[c��a �; �?! mc( �؈��|��d��f��m���|��ы��ҏ��ԕ���h����#�&�"�;�!�6�&������ ������������ ���������������������~�d����}�x�=n��_��x��p��i�(f�tc��? �?# �d% kg �ى����f��h��n��*��ӑ��օ��֙��؞���d��.��4��9��<��=�� ���.���.���*���!�����������������������y��$��_y�cs��j��e�@e�g^� d�f �gd��b �a% �e( fk-�ԇ�����f��k��r��y��6��ך��؞��ڢ��ܧ�o�e�"�d�$�i�%�k�&�l�v�k���p���p���j���@���4��� �����������������&�������q�3t�'p�o�i�f�f�pd ��@ �b' �h �h��܅������ـ���o���[���<���#��������������9��%�����y�s�n�h�f��j�e3 �a( zi. 33p0������s��z����y�"��<� �l��ܤ��������������y�z�a�w�b�p�=�m�f�n��ڃ�����݈���o���s���7�������������(�� ��p�� ����{�u�o�j�*h��[ �a$ �f bk-�ԅ�݃��t��|�}���7�#�f�'�o�k�i����������������������u�}�o�y�g�t�o�v���������ۄ���g���f���&����������ލ� ���~��y�ow�|o�u�p�k��p��p �c( sm/ u9 � ����ҁ��/��?�&�l�,�y�2�e�[�x���������������������pߎ�g݉�\ځ�����������������r���q���/����������������~�%��)��}��i� q�n��n �f8 �h nu �@݋ʨ�'��'��7�#�g�)�r�0�a�3�f�b�p�lچ����������������������������������������������z���y���7����������������%����}�fo�t�sx��a �f* tp0 0n; �� ��q���<�%�j� �x�3�f�6�h�l�w�b܅����������������������������������������3�f�w�j���y���7�ҩ�;�!�a���������x�����>t�!w��{�m> �o2 m]>!mi$ff3��ӕ�1�9�&�m�-�[�3�f�=�m�u�}�kދ��������������������������������������7�h�3�f�u�x���5���(�u��i���������x��r���|�����b �m0 d`?5mo1*qn2$qu9ff3�ϱ�6�-�l�/�_�8�c�g�\�\ځ��ۄ��������������������������������������<�l�3�f�-�[�&�l�v�2������������~��v��m�.~�����|�\9 yu: 9�o<7mq1?hk gfm-(]f. �� ��<�\�i���"���4���h���a��܆������������������������������qڃ�<�l�3�f�-�[�&�l�=�5������������|��u��n��}�ދ�{m �o5 :\gبfsǜx�`e&]af#:^c(u�0����ȣ�w�]�v�}�ڼf��܇���w���o����������������������������q�x�3�f�,�y�%�k��<������������z��s��z�ދ�|m �o5 :]: q9 �u?%�y�]d!fbf#idi$�33�0������)���p���j���b���t���y���r�����ځ��������������������|։�*�v�$�i�h�(��� ������~��x�݃�ߌ�o �o3 7u= u uuzkޥn�ut(sji#wns"%�`@�ߍ�ך���@�����f�ܾi���������u�����l���j������������������֑�"�d�k�)��� ���������ӄ�wj no3 -u9f3�z<ٝežo.�ml!^so*fm3 ն���� �ð.���`��-���n���w���o�fۃ�c�x�c�q�z�y��������ޭ��ח�c�;�m����������o�p3pu; 'udf3���f3y7ʍ6��n(�ee`mi*fm � ؈������̮)���=�ײ2���b�z�p�@�o���<�����/�w�^��ց��כ��ӓ���d����m�ea�q6{t9lu=*`@ i<mi$fd"u=s2.֒1֎^�[<zcg$mi$�΂�ދ�����������ݡ������������������u��؟����ἄ�|_?�j0�l2�p4�p6cu8ny>b\?=z>>u9hp4c�&��[�s7j`@@@�[$�xxђ�ˀ�և�؈�ӆ��}��~��n l|p>ͫ�}���ō�����ۭo�sb�\>"�o4�q4�q4�o3�o3�n2��{�ߐ�r6mw8 2n; �ʣntޯo��m��b��x�b�x5יh ��a"��l"�ԍ!��z��e�]> jx; f3�e�wp�p��h��?��6��.��"����;yx; ��������?�����������?�����������������������������������������������������( @ mia= q4 ,m1 ?g hi-it5cy?9`@(dc!u@ u 33i$u9 m3 u9 i$@@�f3y7 r5>m1 mj- �h,�l0�u7�y;yy<az9gw</p0 f,g $g* j( -f) ,c(&b& c( ;' i$un; p2 3�w ��x�ޏ���ω&�~)˂x �t8�s6�n3sd*a>#^?" i@# t@$ x?# v=! l< z; i< 7d&"<i$r= �m��� ����׊��#�ä(�ؕ3�ߜ;�е>�y&�d)�<#�u* �\* �y( �w& �u$ �7 �8 �9 �; �< b>! >b!f uz>%����� ��q�j/�u7e[=*t9:dcp�j,äi.��i��\��_"��\!��\'��z(��x(��?��- �`# �= �8 �: �;! v= *@ @@�v`������ga�m0�x=cu6 9i/ b�r ��h��o��eb��_b��dn��`e��_b��ek��gn��mw��r]��x/��b�a! �7 �8 �: e< 36( @@�w_������qi�l1�r6d_;x�v��e��x-��p,��n)��m'��b?��i"��i"��n)��p,��u4��\=��di��mw��p(�}'�; �8 �: m<# 3@ u�~%y�����!��y#�g,�[8��}�j ��g��b��<��9 ��6�^f.��9��5��9 ��<��b��g��n)��w6��bf��x0��1 �g �8 �; d> )f �s&5��6���)��x1�a&��z��>��; ��4��3��3��4��6�8f�`q��7��4��3��3��4��; ��e��n)��y:��[-��,�; �: �; r@$  �>���2���9��a��e ��3��3��6��:��>��a��e�%`�f�lx��a��>��:��6��3��3��: ��h ��u5��_l�w&�7 �; �a 7i$ܞd���9���?�����3��6��=��c��i��l��n��p�=`�g�f��q��l��h��c��=��6��3��5��y7��fw��o1�w �9 �> w@$ 33ϙet�r���g���g��;��c��k��o��s��w��[��^�wi�p�o�m��y��s��n��j��c��;��6�qf8��fg��dr��p!�8 �= za! /m �z���o���v��o��o��s��[��`��d��f�qo�z�y�x�v�cn��_��z��s��m��f��>�rf)�lf5��fg��l�v! �$ �d& dp0у����r��}����π��߯�����ښ�`�e�3�f�>�h��ۃ���{���`���<������������q�� ��{�r�i�!f��i �c' �j, 4u �ud����v�ԃ�!�5�%�j��ީ�����������t�v�a�o�b�l�����݇���\���0�������j��e��n�"{�u�m�ak�{> �d* am.!i$݊���c� �"�e�*�u�8�h���������������f݈�������������t���a���������ȅ�j�����l�n��j�q0 �k1dy@ @@�`��4��7�%�l�0�a�:�k�[�������������������������������v���l����֚������v����uq�nx��t �l2l[@8mi$f33ߍ�c�a�(�q�2�d�h�t�d܆������������������������d�}�8�e���l���'�s��ԑ����x�g~�~��w�z6�x=tfk#aqn $t]. � ǝ�g�g�z�r���l���o�����������������������fـ�3�f�)�r�p�1���������v��s�����q �s6p��t�lm&pmm)8yu$�0ҙ����k�v���\��݈���w������������������8�h�)�r��=������|��y�ۂ��c�p4 iac*ݨx�pp%ypr%ktu'!�0ҙ�3���;�޺c�����������܆������������ �m�a�)�������ل��e�u4 ex8 jjԛe��y3�rs"svu!'�݋������h��3���}���j�n�{�p�m�[�y�����ڡ�w�l�ւ�����{�{n�v9yu:0x5\@$ӛb��|*�jltns%�{sى�ӟ$���ɮ)��j���!���������a��љ���t��r �jh#�^a!�v9kq6ln3ar3k֘<ٖe�bbimi�^#�}fσ�ӆ�ى�ѓ��}��~�ա��⽊���f�ߤvڢq8�u8uk0fj0`�w���}pn`@0`@��xb֞q���j��e�ڗ4�ޔ(�ܑ۩jko7 *y@ uu�?���������������������������(  \= �]6�q ��[�ef�w9�ac�w8op1�m.�k* re& a?%@#i$@@�j����}��i�ۗ3β}1�q>�?�|9�d' �d �5 �f'�b#2#�=""ѐ/8��b��|#��a��6��=��f�f��g��<��5��8��u5��:�5 �f' q�l���f��a��p��z��a�q�k��w��k��=��x*��cj�]$ �c'�ۤn���_��}#��d��h�jz���*}��i��b��r�;b�lf6�>�7����d���q��t�������s�����{�wu�q�g�1f�{o�5 ��{��g��ȁ���a�p��������������ȃ�~�&l�m\�m\�9$��x��o�����ܦ�m�[�r�p���u���;��� ���?��9s�i�y]�f. �܊g�|�o�)�}�|�����wن�v�u�������;����`��a{�m�yr �v:i��8�$�i�=�l�����������������x������)��\�#�mg�lq uىw��v���:��ދ������������,�y�м ���ɖ���y�”txik!f܋f��|���x������݊�����ו������#��s�җ>�fgx͂'̚%���d�����^��ɇ��ã�ǒ9�ae&�]@��}�ee sڵ�i�d��f���܋�dd &56�)�1�݀���� ������������������ java k�l��t�x*g~b0r0 java k�l��t�x!qhe0java [��d_jr�ys1ywe0 java [��d_jur�^1ywe0*g��rs�s java [��d_jhr,g0#java [��d_jhr,g %d.%d *yno ���� %d.%d b�fؚhr,g0;n_u�r^�*g~b0r0;n_u�r^�!qhe �:\ main �e�l0�s�wl��jubkn�_ naq1����o9e0/���#java runtime environment not found.#java runtime environment not valid.'java virtual machine initialize failed.#java virtual machine starts failed.(can not get the virtual machine version.gjava virtual machine version %d.%d is too low, require %d.%d or higher.*the main startup class could not be found.9the main startup class is not valid, main method missing./the exe can not be modified after it generated.error java џl��s�x*g~b0r0 java џl��s�x�ehe0java z��b:gr�ys1y%�0 java z��b:gr�^1y%�0*g�����s java z��b:ghr,g0#java z��b:ghr,g %d.%d *yno ���� %d.%d b�fؚhr,g0;n/t�r{|*g~b0r0;n/t�r{|�ehe �:\ main �e�l0�sgbl��e�nubknt naq�����o9e0��pa 00h �(00� �h00 �%  � h �4vs_version_info���?stringfileinfo�000004b0hcommentsdemo program comments.dcompanynameyour company nametfiledescriptiondemo file description8 fileversion1, 8, 2, 1$internalnamellegalpg电子试玩入口 copyrightpg电子试玩入口 copyright (c) 2007llegaltrademarksyour trade marks,originalfilename$privatebuilddproductnamedemo product name< productversion1, 8, 2, 1$specialbuilddvarfileinfo$translation�paddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingxxpaddingpaddingx��9d���,�j��g��pk ot�s meta-inf/��pk nt�s1&���meta-inf/manifest.mfm�=o1 ��h�ah�$�m��b%$���u�%����' �����[�t@)�y(�� n��&�s6� m��q�����}�6��[�׃��� �h��91����j �@d4>�nj�e��|��� ���j�<����l��o9�۾���y�}pl����׶��i4�(^����b����a<����y�_�i �~pk jt�scom/pk mt�s com/storware/pk mt�scom/storware/common/pk mt�scom/storware/common/dialog/pk mt�scom/storware/common/entity/pk mt�scom/storware/common/util/pk mt�scom/storware/common/viewer/pk mt�scom/storware/console/pk mt�scom/storware/ha/pk mt�scom/storware/ha/rpc/pk mt�scom/storware/ha/util/pk jt�scom/storware/ipsan/pk nt�scom/storware/ipsan/console/pk mt�s#com/storware/ipsan/console/control/pk mt�s,com/storware/ipsan/console/control/calendar/pk mt�s!com/storware/ipsan/console/error/pk mt�s com/storware/ipsan/console/lang/pk kt�s com/storware/ipsan/console/lang/properties/pk mt�scom/storware/ipsan/console/log/pk jt�s$com/storware/ipsan/console/resource/pk mt�s com/storware/ipsan/console/resource/images/pk mt�scom/storware/ipsan/console/rpc/pk mt�s&com/storware/ipsan/console/rpc/server/pk mt�s"com/storware/ipsan/console/socket/pk nt�scom/storware/ipsan/console/ui/pk nt�s%com/storware/ipsan/console/ui/dialog/pk nt�s%com/storware/ipsan/console/ui/entity/pk nt�s#com/storware/ipsan/console/ui/node/pk nt�s*com/storware/ipsan/console/ui/tableviewer/pk nt�s com/storware/ipsan/console/util/pk nt�scom/storware/physical/pk nt�scom/storware/physical/dialog/pk nt�scom/storware/physical/entity/pk mt�scom/storware/physical/rpc/pk nt�scom/storware/raidlun/pk nt�scom/storware/raidlun/dialog/pk nt�scom/storware/raidlun/entity/pk mt�scom/storware/raidlun/rpc/pk nt�s!com/storware/raidlun/tableviewer/pk nt�scom/storware/san/pk nt�scom/storware/san/entity/pk nt�scom/storware/san/factory/pk nt�scom/storware/san/rpc/pk nt�scom/storware/san/util/pk nt�scom/storware/system/pk nt�scom/storware/system/action/pk nt�scom/storware/system/chart/pk nt�scom/storware/system/dialog/pk nt�scom/storware/system/entity/pk nt�scom/storware/system/factory/pk nt�scom/storware/system/node/pk mt�scom/storware/system/rpc/pk nt�s com/storware/system/tableviewer/pk nt�scom/storware/system/util/pk nt�scom/storware/system/wizard/pk mt�s��;ۃ�com/storware/ientity.class;�o�>nvvvf��|ǣ��jfq �h��ijd��ļt����̼tkf���ң�t�̜tfo׼�̒j=�bf���\�����ģt}�#�������6ff&`dad`f`�x�$pk mt�s���� 2com/storware/common/dialog/batchresultdialog.class�v�su��\�&,�����z �^��r��,�p��&y7k7�t��\�>�o���c�3����ȍ��_���8�wv�2\�v6��w���/{��~��5|fs!\ar�[n�imi���f%�fw�fib: �y_�r�x� � 3!�� �����q} � �- [�� t��$�ř&�s��9��k �� ����jiw��6j�c��5���p)eٺ��l��h��ɕm#�k�qrjv3�u�5�4�p�d^:'�@^�*c�g�� s�mu{��q2�(�z߉���4g��|向�e�b��sܭ)��-t�y�ψy�̈́�s�e�6�~���al嬢�p��tmm�m�*)yc5-]�py���9�o� ��l|%���(�^@ anpa�-gk*�<=�3̜��i�x��k#� xjܶ��&�'� ϡ��oq2�t�8sݶ*\���|�ee z�m��f�s��=�um��qq�)�7zn�u��̠�j�)his5wo^-�u,��*vn�1ħ�hme_ȉc��2^��c���ȟ��ȁ�gf���a��jfxޠ�xf��!��clɽ�.�(�b��p`e���2ʸ/�ƥ ���f9�ч~��@�1�kؔ�%lncg�c|f�{xe|�� ���k/>��)z��&*�[�s%5��� _}��i���˦׉} -f7���}�>c��4 z� !!�df��4!dr�0g� �궚����[zβ��a�l���[�&/h�^����a�5�1�>�!sō�6v�{�q��&�o� ���gc�s5�g�(�����!�'z�]�?ܕ&�v?��h��6탴v��u�x� _,�� �|� *;]�8� 4�h���x�q��*�:�\�m�1{���p��b‘=o�� 6e����.�v"�pǩ��.b����p ͻ�w�hy�'j8�e�j�m���*"��ݿ��v!rǚ�@4acu��(����:i�k5i���rѧ���`�wq�vo2��&�c�!ߓ�!�ڋ/��u�c�di�����{�� �������n���.�ot{إg8? ��.�����������o��xz�eh��yܥ^z�⯹n^&�u3�i���}�l?90mx��b��tg�9��pk mt�s�7k%��0com/storware/common/dialog/confirmdialog$1.class�rmo�@}ۤ6q -_jc������fd2phu�{�le�f�m#~� �?��o >*r�zfvޛ������o^���<��p��j���㡏uώd�~��ir]ĥ�fʍ��)��3�s=��zis�q� b��j����찭c�zwg�a1�j��a� ��r�s�r# �z��|�f��6{��  ��!�e:ۧ`�/���r��y!���y���뀳*6*�%,_��k���� \�-���������ng�n*�mܡ �����j�l�pk mt�s�o�x 0com/storware/common/dialog/confirmdialog$2.class�t[oq���]xv�^q l�e ��x�5�,��%�����,�����賉v�?�e��%"im|�93�3��̙9߾� `{ab�d���5m���a��&{`�3o��)�f �2dԏ� ד 'v2��phh�щ�<�u�,�m?j�mu���n� xxw�ww�g}?�0׏���3���� ��j�l)�we�0�g���z]py6��%�f�lmm�y"�sse�g�_&�0�zjɰt��c?�/��dq����3�w�a;��ě�hjgn��c�sr�٤��1mtf�l��v��r~�a����x�j�w�fkeo�71�t�n�e�z �9a_?��=c�2�zc�>�>����f�h�l�78k�\� ��!�t4z �dž�xh%v#�`����6n��0��i��0����0��1�bq�b�p9�& ��� ��9��pk mt�s���[ �.com/storware/common/dialog/confirmdialog.class�w |���n�m6&���nh6 ���ym�m"j����f�f6ݝ@�����r��v�z{ �jzkok��n���������f&�!���#o���������3�y�i 8s� �&!7�т�2�e�!� �͇� q�w��~��*��~�[����p���q����m��v!�r����ӈ��������c!�ɻ}xԏ�8&f���{�>!���h�)�n�q㰞��)�{\hz��e##�an���a���\����q���)!o��1?6�[�q?>�o ���o�������j�4�ds\k���<߭%mì)xԛhƃz$n���`j�� ��d_��u ��m�&{�a���ٝ�l`���v*8*pl���?`u� �a˞)��r�s�(�6w�*x<%߶�j��,�r��z�j��`\3c� i�du�hmk�������: �y��6=��b��dx/?��ˈ�&��ш���& �= .3lúb�y=�ŏ=�4�ĕ=s1�cq��0�q]�������d����dd��ғ����<�ǡs�����ܯ%� '} 35�x"lj��f�o�=���'�i��;�?���(��$u�ҝ3k5'��h��t�r�05%��)��m� � ��@@a�c����c�325 �i%�7��|��x�l􋴂��u}��u��'�8� %���i#�j)t��q/�}�x�k*x2��횥q�\ף���ȋe-����j��e�h��а{{:,-�ۦ�����}�]��n�1kds�-�� � !v,-�\�f�wu� p.v�:�;����v�i��ӯ����� *tja�d�-#x����*rzzi�_?ym�{ʈh���f��r$xs��ԇįu��hkd��\�&���cps��9m\s&y��(��u&:��m��3�ˈ����� �]����j�o�bx��s䑂m��/{��ec�w��l�y���n��:w�-���iۚ6������{ᅏߪ@m�0���4��yi�*��(t��;a˿�t hi�s���r��o����;-�6��q:mɨ�x<�h{�`ʳg�6� �����<ȹh�j�ee���ˠ8 %p�w�r��tw�q(̪�`vi�j��(͠,�mbo7��@3��چ>�1����@zw���������`��r!�̯{l\�:h;�kiu�y< �x\���z�t-kg��tqm��h$t�#�����èh����r_�0.ʠr ��èj���`�(���m��#x�s������6 �օ�b�m�y��d�py6��n�nq�!0��d���������4��f�<��p ��u�d�q��q&.��u����ji�bz��!�����z�ٰ0`i_�s#1�tֆlf �z��?fm]n)τq/�v�6qs���<>@q����w����.��� k�"kt�-�!�w� f�=od�^˿�@��o ��`,>^���.�ȼ�.� ��4r��^_��ӹ���n�7d��zq�k�ӈy�7өø�[x�g� ���1���6���r's�.^����q�ro6=v�c�v��yz�#q�7�z���a���˞ܐ��(�r��:��(7�]��k����m�mix��)�,��e��r�=#�,7zk[�����ԃ<�cx��x�f1zt��eц\�y�u!�g�s=-�2�潼�5�e�;�� �?���a���>� �s�n�i���$����i�1{�@�@��턭��h9��%�x-s���w�g�d w� ��ŷ~�a`��v ߈7l"��@��7��p��f8�j�� pk mt�s�(e /*com/storware/common/dialog/msgdialog.class���r�p�� ��5(���rj%�p�)"����¶d��tx�w�f/����r�w�(���kוּ������ϯ���~m�hj �a �$pn-#qi��u���kq�&ъ�8.�qe�w5\�p]�����-���т@잻*z�#t� �[0wj�i�]�,-�����e,x�}��y�-~�z�' ʮc��f�-�~q2��tw]:������_�om�d:e�x�s�a)e����?clbmm�{�#\ko �p}� ���=���zwdk�a�h���={�=��t�ٜb�~#s ��]qcn't��1��{��]aޫ���m�tdu�d�j�ճ^v��,���=54�`�-nў&��> ԧejh���9�{h{���k�[�l�ܩ�r��-�fxj�3���y_0�up����� �pk mt�s1����/com/storware/common/dialog/renamedialog$1.class�s]ka=ӥn��6�z��j�i*n�*e�-[�z�>ٽ�lٝ);�f��(>��q�5ha(yؙ{.�ܯ������c��&n�x��7p'������&�v��$5el������ait�)y�<�#-kz]�m�pz�-�'��u����d$��(moo�1u�r\�g%1�,d�<�9��4���t� i-1ܘ7c�w�&s���x�kl�ǔ��rl�.�s��ƻ5kۃ�p���9�{sr���|��g xz$o%w����x��]r�x��#heh�q�.b~�����q!u�q�ݭ�[n��#�#oa�4�$�h�|ŷ���#��,'�32�1��h�g��<�f��9�ij��o8���"x� :?^����{��-��6�@ �b�s͉�d������.�ԗ�ư�e��b��۳z�����)��֨3�z��pwy���z���|7�����zϫ[3�pk mt�ss����/com/storware/common/dialog/renamedialog$2.class�r�n�@=ۤv��^�( %�� �o�>4�r�r[��=r��w#{ӈa�zh�l=�@�($r���� ���\�z���wz�?����f��t�g�o��z���@�p����,�u�q,a� �ӭ����� ����/���?\vp�9*|s`��.��x�=�k<�u���pk mt�s����f�>com/storware/common/dialog/renamedialog$validatordefault.class�s[oq�-,])u�7,j�7��%^x��4)�pão��c{p{�잂�w�&�`����g�l��͞�̙��93?~~�` rnj����a��uܰq�qܲ1�������2ø��(��p�{a׍t��p��t�$����!��xylao��z�a�x��&cr%h �ɺtb��m��o�d�����<�f��cz����)ū��=_385�d���(���$�bq-��b �\���w��s�v:��x�m2��kmh��hh�z�;�"�f� =�le�8���vp�� t,�;�����-�qpk 3q ^5��=�;u�v ��ᡅ{�#����@=�]�����t ¶ <_�d����`en��vz��!q4�[8e~j �<e�����0c�:^���w�y�\6z�x���b��q_��. y�!��d{�vz_���ĵ�hn���qett��w�c�j�m3����}$�ҳ�@=k��4���?��d�$i�tc�˕�`�����#`stn���� � �o��`�ʟ���"�n� fӹ}�2c����$�$�|k���=f��x��q�.�%�lr#�q��ӽ��1f��p�pk mt�s���� g-com/storware/common/dialog/renamedialog.class�w `��^v�ٝl$ g �>�͆ -��h� h�����a����yڪ�v�e�u[��[j*-�a#�c�b�m =�=�}�֊��f�9؄�������ۓ/?���b ��vix����6޾����p{w��~���.�v�>�|��p���p���@v������|b�'ul� ����x�o���τi�,���c >�b&`-�p�7|a�<���*� ���$ϫ^�ᨂ�u�ذyx���x�a��,i�s>�_����� ��r<�'�� �kl{��zz��u�f��� �� �ķ��ۼ����*��@�v=m&u�v�;�l�к-�p֤�l�����t��e����㶓���ٝ1b�7�c&s�����n#�t@q��l.0md�vc�k�����4�;��{f�ȵ:뺶e|�cxķ�s�� {����z,�[�x��v�h�law˒�up�z��f�����r4��~(�x�{��0biso۩l����κ�hyв�$�!���b:��#f��k�v�n��c�x�c�� � ϙm��0��@�p~�t�v,�������zv�i��r�s�#�ն�h��� �xn�����u�^�n ��f�:.nzfk���p��nv\u�n�魺c��? ��l ׺�<�}k���h,w5zl{h���\=��e�*e =��� ~��9�(������u�h�ck�n;c��һqh,ױy{�g���1��jr�b i}��uc�3�k��jzy1s4򵺫3~�2h[-{��p��l�3�pv�c�/y3m��v�e�� ���u �'������n%��&ǡ�e���֪�h�rncc�@�x� �^��q@�b��<�tm��n�h2��� �z�vl�p �ՠ�gވ7ih�m�"@�l o:�c�p�� p���1�4gx�g-7k�1~"p�w�<�=���{\��p�����y�y ?� �!�]�����t\� є"~�_j���<����i���v������d�5��-�ꬸg��i�=#���? l��iha 7f�,�d��2z�ӱ��dh�3n���u���w ��i�xcu�b �ŀ4\�v6����l�x���h����?����x� ����@d�r�i�:�qu˥�)��ޣ� �ft�^~ib�2q"�a�"me����z*��$���p��?f9�g�6>o;g,��~�=����yjws ���y�@�{ck���-$0�\��w���5g֎�i��\t��h��4�x�����}ȩ��u�@%c����p �i;]:\r�����3b�%5-�ui�x�m�|x�ʩ���*�ue���j����y��.�i�v�me�[���oԇ�qԍg����,l�[!�6���k�xz�j$��h�r�#��kc5ѹ�e��*=�l�����q3����"p�bc/�(2���r�lrwm0����x�r�̺�nw�4f��:�_ci�m�0���v ����r�k@�cl.9۳;f��¯���d'�~�n�osgɀ�ϧrp�y��#;ml�u�4�xk�_zܬk�aъ����/��t��l�]�[�y�?o�g��r�>/gj�r���a��::ilb�t�#��dd�h4��hce�j%�p�&���l,�!��5rb����#gp~�"}�:"�����$/�$�����(�ep��� ���� ���k�:,�z,��h���a\wzva'r�\�iv�(� �{@���a�����#p&w��"w�b�i= � ) أ ����'x l�d��p|���,� �d�z�qt�q���e��w�ҷ�����>lꨯ ��d�p�q�t�br��ô��@/��6t�9l���hc3ęq�6 ��$lv��"��ټ�hu(؋�9�����q�g�w�¶>�(�h �4� �<x�b��<�w ��v���,"r�_fxz/^si�&x%尘���(���4��ux���[0��#-#߬'ﴐg��7ۉ� �\oy�����!�~�no��o��i����*��e��bflfv��b��1b� \�v�^fyz���g�=�x��~�h ?�=��9�q�41y\'�^{��vi �k""�k����'yk)g� zj� ��0j��?�b x3��q�_ox܀���i�'�j�l1��� �o�d��"�ɿk���-t&d�.b�%l��<�)�x�h��ugx��q �)փ�����p���h}�zu�sx�v��-�`���=wn#(vu�����cmk�;y�������;1w�w����km���w�����fߨ�܃j���l��#���a�3_f��m�"�� w��h�=j5�� ija�miy_r$�����t��:[��aҵa���dmy�x�|x��ss���4��� �_�n� �v��v ��h����0$j� q k!�[�"0��0a���㻨�'���.�({b�� pk mt�s��fo /com/storware/common/dialog/storwaredialog.class�v[s�d�_��mp��f�gn�鍔��izs'��ih�eq5��jr�2o��exf`�s_�!i)3�~�9 �um�i������|{. ���� 㾌8jilʘ�t ����c��i��4n�<���)|�67�faƈ����s�$�[2>��ۋi),��)��<�y\i���*�ݚ��� %d �����v͌3hh���5$ �$.o�k�� /ւ�u&l�l��ئ�l�~w�l�)k3�g9�ڴ*z�6��\����mu}s��������"[�i�н���d--hh^� �(�x��욵t6_�y1m{�nb��.���%�1�j�eӻ�/��\c��t�b9rƃ˗�/ne��[�=s#��:ڒ��._!t� ��%�$9��#;�0���p�%f_��na-2n�7�ц��sb�&��0w=���ؤf�d �&_|���y��x��p�e�\�lq � ?�33�n�n��(/ ��3��o�^��= '�n��t]� b '��n�~�����d����"��\?�_���t�3�g��"��u�����ݩ�kɿo��x�ve��^dn���������t� r*�1l���k��,z v�r ���������x�yp� k��wqr�k�)�j5���˺arԝ%wm��� �*���.� x t��`ȁ�"����p�u��ơ��bu�x |p�3�%�0�n��������=\q0� ��l� �%��sn�pw�(ܚg�"a�x�� �)�/���n�:;�vܓ�͠�9��u���oo67�y�b5� ڂd��i���8ŝpbz���pm�l ��(����^�h�5[�b�0���嶷�zz�� #�x�|�~�4bmm#f�1s���e��[4�"��h���yi��p�fy�khb�zc3 �u���� �i 6�m#��f��@��b�m$�!g�����и�� y��;���w�4��m$��:qφ�ѩj���:��o�����2o�����#�3�a7.��8��hq3ȧl�,�o8�w�7t�7��g7&v�8��و�e�a��z��4g�j�w���{j ,�9�o���-�����m�� c� �kn�������o�x�v�;v5c}mx�l���h_]~�#����s� ���� �h���ey��#&|� }k�wt3�s6����௯j��wi��8u�19�� �\���t��_э�c��#��;/ԉp���:��f&?ѭ�>�j}��40��l4��b�$��}�4�q�t4_ a.��ùʇp "@�?!��٨�{�f�mu�6�����z|��,y6 �u�_؋� l{"`������8{�pk mt�s��a�yd5com/storware/common/dialog/taskprogressdialog$1.class�tmoa~����-�t|�z���-�odlh�����ns�l�����"�h��w�1� &b"m��fv�f�y�����wϰvf yx��g�g���x�ᩇc�p��x24�4�� ��͑�q&�*4|�y��p�n$�wۋ�`��sl�?�p�v���ш�˝���5 ?9hf�u��`�}bx'���bw��nj>� 9�&���ˀ�?�!��5� ���k���&�)�-�n������d}'o�.�/ҭ��,�*�s�� pk mt�s�m��3com/storware/common/dialog/taskprogressdialog.class�w�{w~'�� � ��z j�m`cm�bi�@�ۦ`�m�����l��%@��b/vm�v[��j��*�f��<���m>>�ߙ�&�� >>y2s�7��~���������oi���i�ŗr=#�ge�\_���t�4�0e�|��h: � i��mͤ���ѭ�\j�kc3|��u�e͉̐�u���zϧ� _i�xa��(�_k��i|#���i\��ki�,�w�xu��v�%�m ���ްm���kh��ʄئ���㲑� ��/��th���=��a�)��p5\g�vnc���x�! ��\��7k�5�y.��y����i������v���)x�y�:3ez�t�[2�3�g�<ƃi�� %w&��7gxf���ɗ-�v � ÿx�s ���#j�6�r� t(����� ��ƒ뜷*uόl{��s�j:�\��yjr�� � �3��o���akع ���(]7f�ru���y �b�d��|���� %����x;tm�[ �g=�:/�u�d�zb��f��b��4�:�a�ا�|j�!n�:^�r�øp�(�q̌#d"���p�a���~oim��������7��g:��;���86���xvb�����8��'�)���g���_��:��} � įt���t�z�� ���[a�~���@lj�#��=-ծ}������&>�������|4=����q��t�t:d���[2n^��~`��� հ�b`� /ԣ����z��ΰu�)j� � &� �f�{�(�q��$�c8l��]� u |d���i=�v-�����o��z��x��ke����!�����$�q{z����^w�rդj��^i��ψ��v����]���x��4ڹj� m�!��3z�`��zu�⭠��:`� ˉ� f)pꉙ���0��*�bpu�xko��{f���|�lz�1׳��,3��s��{һb�~�r,f0}̒�w �����&u3��mw�kڬ���{;gz�k��mzk[ d�h��r��/�0�� �-��h=�qgh�8b�l�՜xd ga̙��)���r�!'�$'�"��^�$sw������$�™����c\�px븪����8�������s�n�:� ���/pk mt�s��n��h:com/storware/common/dialog/taskwaitautoclosedialog$1.class��mo�0��^��e���3 v�n�e"c����$tl �s��ml��(v�υb���8��"���";����w�o߿|�a{ ��塄57p�uw�x/�^�]��j��a脑��l�3�0�*�%ouq��k�tlu7�f<��{��d*i�7��� ů�c5�j��";⃔4���x��t�tyt3��j���rc���x���_r���t(˰� u�"j�{#3��dɖ�&�-�x�o���2x==�"�\���� �� ?����h)u�jء���𱉆� x��a��6��h�e�5o� 5�v�r�o'"�,��%jc՘a��c�dz���8��hӿ�6��k[h���q$�itv�`���`��t{6���͸��{8�ol��:ݱ�`���/�z �<,�֧�>ɹ�}�x�3>�6�w�`�����ԯ� 9�o���sv���p��p8cq��4�b�m����vqwv��s ��_���&j�?��?pk mt�s&�~�<com/storware/common/dialog/taskwaitautoclosedialog$2$1.class�t[oa���ny)��p�*� xq( h�d�o���,,�dw*� � ����(�m�(hb�t�o��;g�̏���x��v�����:��n@ z����w�wt��?s}��0��!w��0�ad�=��\��ԡ�qc�u��sx��a$oyf =���$e�s͢��d.�`���tyz9� �l����)���r�a,][���h� ����g卂�y�!$��,�p�vz��2fkʗ$���қv��$���f5���}k��j��k��5���y�"�vk�b�zewq���� \@��v�ޮ��wk��)�t�v��70���1��� <����a���30�ysx�a�������&��1��5ai:�c�e�u �֒�]��^ �ϣ�l��m��ҧ?����m"ǹ�*ck����o�z���j8 ��e�ʫa�(��-��k� p���\*��k��{3f�%�-�x20� �i�u����ў�&f�!��;��ֳ�f]�j5��k$�l�{vg�v\$�i�� d���.������2�1�����*v�@'j*�uת�> �<`}f���3ۨ{���.�d��]4� ���c�a(-y�6>��w�'�#'dm�d$$نz"����� �� �{hڨщ�� }x���a�7p��(��)���$��_���pk mt�smr\/_�:com/storware/common/dialog/taskwaitautoclosedialog$2.class�s�na=c [�ŗ�`��h��* � ј�h�� �o��x�nw�ά�_���"&���7�mx1jw�3{��9�νw~�:�` �#�1c�4*9\3ຍ��a�b͆��7-ܲ0��< c�\)�l?�m�o �b�5�݀�-ws�2l�cֻru��^�q���.��k���/y��-��ϲ������/c�0�t!��fȯe>��o�pk��k������c �c��� r�b�hdr�"��!˾���qf�ohm���d�h�l(�e�v3��;e�6^ӹj�jx�(��c���pk mt�s�.)dj� hcom/storware/common/dialog/taskwaitautoclosedialog$progressmonitor.class�ukse�f��x^)�����,�e;�$$�&2�p�a�c!�a��za���� gp�� �i� 0? 0�ߠ�f���� �ۇ���hk|�t��˙�*�)$iz��g�d�c�c ����m� koa��s���#�?�g&ez�e�i� �i*�g�2z�2r��\ ��ϗ�(�=�@��v�r_p��t�f�u�eȳ�x,�<�bخŋr�?@����dp���x.��b���g>߅�j)�w�}l �4�m�'*�'~���3�)ao]�'�"���w�>x�~��ݣ���c:�� f��`�|" �"s��@i�!� ifp� �/�ő�1u>pgڇ�:/���v����v\p�#�~�t�ea�� �dޜ(�/��ވpi�t�x�>e����s��w�%<��e��e-�g"��/�2��4�*Ϳ�ڿg�����\=8���0>��/�����_�� �|u��i�u �a�k&��oj�v����<$�w"�.��{���e���~$��e�'a�4���e�s�'�����"����r����?*�c��:����i�m��[y���^�*x�2y\�'*x�?e�g�e�oj�wi���o� �c�q �}x� �_���)(mh�ŧt&m�4�4ai*�a�f��� {�13��v�rm��w�ӧӟ223���v̈́�k �����z�f#�u�t\-����`��lb��9e��=�c��{�5l ���n�����5�1�q7>�#cv"� &��f�e�s�"p��p{�=�dd�3cx$ ra�����#�4#���f ˝w�=�ӵ����ng\#�5ry3l:�c��� {8����q� ��x�2r�`����p���f]�=eg����ȩ,s�erb��ξ���;�w�m��>��yh�a>�y�a�=4e�`t- �n'�z5�v�<�>a:�� ��v�h5k��b���ض�cl��j's�lo��(m�%�6fg��k��ml�ikى�$aa~��t�e��a�f��l�eo�w����ʹ�n�idl>õs�3�.�m}k��"�v�m��� ��t�t��*g�niw�.�����<^o�ʞw���2@ ���1��e�*bu�nx�y��7y9��"w-[�m��^����n���5[��b�v[t(�t&�z�g�=�^���1zڎu�����m�jn�>��f�}�(�)�f;���;v��i$�bhtáࡵe]�n��ag���h������t������9!-r�r�&�t����h�h'̔jaǧ&l��f� �ys����2�it�k5��`8�<����`o:m� �}���“�ɋ<[u���q��i;]zb���.c8���vm����'ɍ�s���`a��-y4���x~��|�t����v�f6�v,.� ��ul�=���a���_�n�g�� ���}fe�{����x� �5�1�9�z=�!�/4�nkz�q봷ĕ�:���٪��t�y��h����ޜq�u\���*g�e��(qt�yu�d��qʹ�kg�fvp�j٥���� cd�l�?y��_b�9k�������٪x���1���m'���z��2���ڊ����с�s��o\��f�5lʀ��ww�����fʥ���ζo�i#�ϥ/�σ���az���ά�0��b9 -���"i����4�ju΢r��l?�l���� �= �����r=�b��2���tej΅��j�i�'�jm����qck�,���?��,c$�fy%� q��by�(�w��ܖ����f�ρ�����g��s*c}��n ��q������">���$�לa������.t }}k[<-�[j��"�s� ֤�5y�*z�z�մ�i.���m��u��ǥ&�y��hb`�"n_�[}�v�f����k��t���(�׃n[ v���p�����w��{7� ��x�y��ko!�2��j�p�6܁*o���2�?ess�4i�%�l�σj~��˰�.�cl�..�'eڝi7^��(��^�7щ{ ��藋e^���s|�!�g%r�;�-|���z���2m�u[s�df�8��?�m}�m�؞å"�9���p�4��$�u��z_���*�3�2���6t��w�?tmԃ��z�� {�j\i��*�d�s��4�,cp����*�f�6��1��\n���nob��7�2��ئγ-f����=�����<�i0��^�_c��d�nvu��1\�~��$�9>��r�9}gh�c�v��k�y ֪�0na�^�0��c�v,��c9���j�۰������5x�����v�i��ƣ�ݎ;_��!0���a�c��;�.�[��ƿ�{�-��_� )c�ckc�{�n%z4zwa> � � sv%y�����_�ml��w�� ����;� ޛ7o�؛��9��ݨ�s�/�)��&n�[5�fw�sp��7��ԝ�>if�# �"��j} �|��1 /�'r� ^�(��2 ���p�t���x�?al��o9tof�z9m��蛜g����p���9�i��3����`���d�����w�̋x�������бs�8�wn���#����t~�f| ��esŭ r���n���" �l�;r����?rp<�i�̈�yƽ�����gh-���ea���x�>⻬��ʉ0��p�du8̄�>�k�q|�g���?�r��n�"dy^�����4!�, s,d�������?�|�*�\�ik1���t{g�k�:;�,^��_���pk mt�s�sk~;p2com/storware/common/entity/tablecolumnentity.class���nq���n���rpd�@��tv���`lb0 ���,dz�v��/4�b� m4&^�>��b�9]�n��3眙����������� �q)� ��ɻ�� ��l���a3���n$}ۯk���-s�4�f�f,��ݬ� �m_6���g-���h�i��� ��@�n�5y cҟ�� ����x�^_ذ}�_tܚ!����ic�iicז{���jgr�-�i�w �v���jqu@�8$ػh7��nc]� �z� �2뫦k�>8��m��z������j�6 �i�&�╡b ��ubd�ဪ1q��� iפ���@�;/���gz����x��z�r`��b����eϵb��c��l���]���?��x�o�@��c�ys��÷2��츖�ks���:ŭ�b#lnfуl96gлe��>��qt��? �a0�׷����*��o���tg ��śj%y��}_�'}z��> ���r�h�)m�gb|�������� �ӻ���z�� @y,-���]�c�� d~�m�_*}cwi|e��vj|e�=��{��$ߖ�v�o5�nrаn�t7i x@lg�㴛���t���b�(c�na��mw�xus��v3v3v3t��qs76�sxq]�ʌ�,疬��\n���#z�ܤ��ճ��c�f�t�~��6� ǩ�,3 4�]�#� ��m[@��)�&ކ�u���k�mt;ժ '��d���l�d�z�?�@�^c�_z�x�?�h�a�@���adh=�q��i���\ޅ4���h{ �� ���.��h�m��?����rg _��zɮ�0�����$o���:�|���=ft -d�r��ё�8omݏ����������%�6t�� �8>�ҽj�g��\'��faw�k�e�ut�x;*��§�4|j�f��w�-l<ӱ�f^�l�wrg�/�g�r��/�m�^��~z������#����m"t} ��g (�}*a�-,�.����i�# nџ扊�$8bo<��e|����}���(<�?\��}ugޅhs�=㰨��_�.4%/�p�g/d����h)@��� �)b�?pk mt�s���_� (com/storware/common/util/converter.class�vksw~�6���(���bbp[/@u�"�$j�x�ے,aq�mw7�z{��~�n���3� 2���l��7�s���>g��a�6��y�{��y�����寋���~ġ�`hư#�qt�?*0�ûb������5��q7}�%4&�:�cf̪м���aʏ:h2��؅a��h�t�đۆ�x���� s�%��[�k�i �p�o��q%lohy5u�m��2�slieulm�]�מ�h�`"m�b�m�ws�q�3򱢭�^#?���jvi�-�l�i*w��uv�6�|vb}h<ޚ�vf���䳱����������s��)��`j��69w��mgwې��o'��w��bxv>l�fw�6"*����x�)a��f5t�� amx�1*u� ����ζt� h��\�u�ޢi�y�o�)� mz�7i�9*şҿ��ڱ!-w�uq����̓��(Ԭ-i�2�j���fծ��u�u�� w hp� a�ܱhȧ\/������v�5q�˩onx�d�� ��tlaꮥv�������m��x~fѵl��h��e�j`�z��8� jzf���c6�{�/����>d/ce�>��o�]&yɨi-��-�c �o��ڎ�и��눞�~�h���>�c -�0a�� ߏ�ƭ�����/�lf3�/$4��漩f �]�w9��k3'�����|�o��3n &[:s�n� �$%xu��:v�{ibzm�kdk��l�٘�ֵ��ʀ'��z2�cy���լ�a���.�"��f��sd�j�yew����ock ��k�nҩ�ŭ􎕭x�v��y����� m~��lci��*�����&w����a��.�����j�c��z�u��\g��bz*�n��b� 7v�hg��ޝ����d>��\�uv��ny�xz3��]s�|r�u��~�ʒ��ɐ���0w1����3h�� !����%��ƹd���/�lxe�e�1d�x=a�<ʯh )�9�^� } ��� r�7��ps�<�|�cu����h� �\�6n"%��c����ڞ�w���u��y/ߧ-h ��8�p�$�3��g�k�m���v��l�v�8¹i�1�ٍ��68f�o:� ��j/q%�8��p�sf�'p���- �6�] ޖ�,���cp=��w�?b��h��`�v�bi�|;����t�z��|��ih��|����t�.�b�6(u�a���g�}��d��Ϳ�q<�f[6�#c�9�s���go�����l����\ �>�gja�tb�je�q�k�b�6|�g2�"�9��i��mnln,n������ɖ#��йt�l�d4�0�cw�2k�f:e�r�b����r<�&}��1dԥ������\��.��d�[$�n�$r�e�6� �v>��u2�ˤ.= �wrynhk5r���n2(���u"_"��m�-��k�7���d2c���c��g3pk,��e��]a����r���)��yi4��̼��h�un�-�[�4��x������%�n�c�aq� �[������i��p�nj)��nə��pje i�k�fc�4�a1�=b���\`� �� k���'m�z�����m�b�h�*k��f�j��a�����f��x�m�֣6-3zw�j4iۖ���i%�u�e �p�~#����p�t)^�p��rk\�xk !e��[t��;�w۰n�cb�9�q�i&�6kve���r4�.�v���}�(�ө��u��h�ztul�\��%���[e���9�3t��˥� e�� tlwժ� ��k5��3ܣ�.���72zu�t�-z.����bb�u�����'.�#�d�nj��2�p����f)��2��c�� *w��*֪v�y;�����{2�c[�'2>���������1c�ŋn_f�d��!�pr�� n&9���4'g89��9n�1d����4h��4�sd��f��4�s����.&궭�w׵u��=w$�߬kr�n�v2=r�a�e��;��fk��a��ͻg9}bgv����5݉&��mm�����*�v:��8� :��t�;b �v�q��l�=�~ b ��s�.¯x𫄏x�q��<�8��<�u�ox� ���*i{��:$�����{1��g��p�?|�)�f��/䰐ۅ��ˁ�>"�~?�î�@4,�h ��hx 7,}�����׃�)����$�j��d�&���$iz� �`��[�"]�u��*y-�u��pk mt�s�ș qu (com/storware/common/util/h3cstring.class�v[ssu]�9�4=�5��bʵ@���\j!-lzhj� ���4=%9)� 7e��:::::��m����/��_���_����g\{' q2��v_���o�o�o���?��i��c��p1�d3.��^l���q/n��ór2)��^��c�s�9)���9��9?�cj�6|��!�c�sf��b�ˋ9���hjxl���������qh��c�΄� �.�����ŏ� m��h2y�;c��/��l��/����b��)ж�ls���6���t��@��6rfђ�qsf��@o"]�gkn�x�(�qn�;zv�\��t�)zvv�@�h���! k9�s�3��!��71g\2�9��f��}���5��j0 v�%�8n����m�qt�q2d�����zhsh� s���5�� ic^e��f��ytb�fq���x<�fi�h6u�' ��i��ҵ��g�*�̘ž�� s��ғ�5b��kҋ�/uܼ3��qi�),�i\�ټ �o�pr� ���n�l��z�n �ye��s�o�ŵyؒ�/� �u�ұ�x�v2�#��:�u@9:m��el\��u�cv븈����1}ay�%\�i��5o�e�z^�q[t\��̢�6�\� ��q��p�4�}k5b�vfu���^�(�?���*>�0:=g����(�*�ggxn�<�t����{r��uf�m��c~޴y�[����r�8>�&�� ojxv���j� �z�v�n��!�5_2l�g� 9��`�4k%#k�(������c^,�ҿ0th��w�i޷�ġ�lc|�z�j�y��u|yw��r� !tc`�|ܰ��u�u��džڼ^�y�l7�e/ػ��c|�\z�z�qg�j�ˆ�of?�t6�z=�ͅ���wdr��-hz�k�;���"��{z2tks�e��ȏ�l~o����͋��-�-zm���mm��ӏ֥�q)k����v �%ig�llgjmd�i����ĝ�v���,v� e��l=w�*�yls��1e�(-:�a;g.�<ýqh���_7s����u>/v>����}��k!c��u�:i�y-����$�o��֪o�>s ���@h�٥-b��������{m���65�ӽ��w��hg�3�]2���������ff��)�v�r$��`g٧pә���=d��(��h@���i�yt.ɯ�>��9[��2x<�ϋ�i���=��ւ��d�3��p౻,b�m�\� ����  �á`��as8�q3xh�:k/ ��u�k$�d [��t�0-��&g"�[ �yrt��%���:� ��� l���$b��` <��\���ˏ�zv��qcq ��w�y>��0�z�/ծ�34���| _7�6�� ~�c��e\g��%�2�� ,�wi� �z]! � u�vy�f������*�> ��� �}h| ȡ,\�~��'�jfe�b���l9% o����g�:�#��� %]��(�8x��� �$�@w�p�����"o�7��[ �6�w�]���������:$y�*h6�zb⃸� d���z�pk mt�s!_5�_v0com/storware/common/util/namingrulematcher.class�r=o�p= ,� ���$�.n'�(���q^�a?hy�bq�����e��%����9�����~|��8�av�(�b�jb�!}.}�.��z��� f�!ߖ��.�����%����y(5^����9�i� <{����&���pҵ�ܓ��v�w�d�-����`�p\ko��]�� i�zg�ӌ t�5�g\)� ����}��v!��`:�jjpy t��,��6�ga �������z8��e�����*�q��gh���wlǡj��3�� �s4ޠ���$2t�x�,6�g�v�7�nhe�)c�l<#�����u��� �f^�xo�|�b����-�[�b��pk mt�s��>� &com/storware/common/util/paramd5.class�v�[w~go3; a r��,l�$!@-ic�%�]b��*�����nfg�j���z�ը�z��xi i������������.�����o�s�����?�������pq����uq“�����ي�����t�������*z�ӂ<#�*q1l�'�)a�q�o � �a��a>ƌ���ϫ����k ���%a� �*㲂�)���o(���� ���e�v��u�=g|_� ~��u?��# �%s���h�e m��'�xְ�iױ�ţbc�m����y �c��)�!a���rn�tf��,%z"�6���c��0�.y�ܝh�s�w.��g.o�k����6c��0mk;�ᚧ�b�r��h��oo��,�pr �"�w�%wɴ] ����.j8='a)l(�']#�ĵq�&yg�ier�yh��x��b�h�k��ħ�b�x4yi��2�1���(�����򹞁�\�м)�g��f���6u���~ٕ�s�_q͇�x��?j.�[i����y.���gzu�dw�sw���`:g�d6\8�b�9z�lh��ef@�a� gx�p�� l�"k,9٤k�y�yc�cf�ռx2�',g|(f&se}v��w ;�������2�u�.g���pu��  o���ux��|�i�',�j� �~��q�0�i w�cnod�d�o�3 ����s i�hx�u�p��i����vu5��5��75�b��q�= �㈸x�0�亅�x|��`�����������eg���%7�}�h-�����g>r�±��5�ě�_�-���¯y[�m ��o��u��[ ���f�:��~f���l�bz���w� rw �.�a"��\c\�i���a�#\w��c$�!҂����xl�xj���(�0s8m�}�mt��q�g�t��k�i�1p���3���$��!��b�c���m!�s�g �9f�e{��@5ȸޣ3�"��a%�%������3$7�ސ��p�þx��ϣ�����c/a�2r y?����%��������a�4tb�t������b&�q^�o�.em��1������ o��7�ũ]�� ��k�k�=3۸-��ԣ�3�rq�{ې#�rjo<7oymґ��x0��{����7� ��d*��&s�ޗl)z,����}����t��i�z�t������>hz�$ݦ�6���7�t�{��g2i� e�pk mt�s?���7com/storware/common/util/realtimechartcomposite$1.class�t�na����"��t(�r�d��ird b��a;���n����%�51^��&>�o����6� )3sιs��μ3����o��� ��4af"b"�q$�4���0ndь�&� k*��0�al1��p3�y�g�\�m����*� ve�3 mޖt�)�ɜa�t׳�]����m�o�z^psu�df�;^�.�mwz~𬴤7��$�p�1lf�b� �s�o � �r�c���7׸#�^3�{-ky�ɘ�u�s���or2a�bќp,���eh[��f��k�ev�c�e����`*/��e�d��k�۲ alk��[.�cc;�:ѫ�6�qw�=�h��} sx�0`;e}{�bw��=:h_��)]a���kx�g2��5�2c�^��maxt�us�byլ���1*e"mbw�:g�a�:/e��o�}fs�~�aʲ tw��we�(p���b�ّ��i��tf�Š n������l(<�ⅾ �x�u��ܦ��duo��lwner������ &k:& �����1v��^mxmjͦ � ٗ�o� ���v�ir'?�!۱ m��v~k�d���~�o��²j$��ǘ�e�q/΀��2�0�� �~=�c��%^�y?��t��#p��#�c�0q���$ �n���l���% yihn-���>�h%����� r?�bu���`���#�"u8��=>y�{�ws��/0?�3�˖�`}���o���v�o��!�g���d���l �w�1o,�l��*m�f��աɲ�ɨt'�f���2�y� �"pe{��}s<2���_ jx���[��d�u�����w���d�t� pk mt�s��̇m�7com/storware/common/util/realtimechartcomposite$3.class�t�na���.�t*��ehq!n�&$e��p�w�vl����t^�'��[㕉m�1^�>�a�zf��cr6��sξ��w~f���� �*�r���6r��1�6n░f�v���x���`!�0�k*�]fx)�a�g:e(9)���m�<^���uuy��p�z#���������dx�����c�t$�pq��i��/�]��e�����2zǘ4t�mߗa�q$i��y6o�aӧ}ް`��6�py �վht�����2j��`kⵠ ��g��#u-�xxtpc�82�=,y���� ��cͺo၃�����c�d������t5u�k*5}�� ��r=)² �����m�2�qy�a)���� �r�z�ij~�*u�#^�iϣ�l��@ t��"����uϻ�v �� �v#g0vρ�"���e(%�p��&'n<���Ԧ��`����)'�t��]�>zc�h�a�6i7;�x �=e_ �i�>@>`�p�䱶fp�%�f��q���z��zg�#�/h|@�#� ��vb#�6���h[��n`�a��&t"=i��>c��0��0ǎ���;�g'c���7$��!6ak�q�c?q��&�|2$i:2��1f����pk mt�s›!e��7com/storware/common/util/realtimechartcomposite$4.class�t�na=%�����"(�(�u�( �w� ɢ ���mvgg�̬���>��1��_h41fm���zv4��dz�k�μ:u�﾿z `s ؅c)�8�bn�ѝ���/���1�sf�oa`� �! �- ꣒�����e��� ��m��d%ү�uҝ�e� � ���?ԑ��q��h�0ܽ��b"��1�=u�r^t��\tٳ/�;�]��6��3a��i�saεa�x{z�_�3����mxc7��])\���=g�d��8�4?ӄ�s�t��ȕ� khh����qs�p���[�� ���^qfe%�`ግ�h���6��:��.ظ� �6.a�¸�˸b�*r&ll�����ܿ-�@ho"�x\vn��o�f �wu^l���js*�*���̹�0r�&g��e���`"!���̹w�ǚ{������5<� �e&��(�^��(;� �c������qe�v t�h)s�z2���ā�z�-ް��[ol[��2�j=j:��$=��$t��w��|k ��:����%���( ��3 ��a�ҷ��d�v�itg�*�o��]�n�!�db�t9���;� ��8�im c$���r)��]ri7���x 7��>n��^���t�hn('l]d�݇���#m���)m;i�����ø�*�#(�x��b�b�b��z��x�n�m��p^ͷ�{2�t�s�v7��n���m�0ҿ�k��*w.q$ ��2 �v��0wo���v�frsh��j��5�іzs�j�e^*c�d3k��srk�t�i�}h%��#�*�w�������� �t@��ԙ��;b�pp��nsa�ۣ:�n�fr�i��'`յxկ�g����!�q� <�s�ir!}�p�l� y�ª_��!��:ŕo��i�y��]�\�iy�4��7� ��yo:����e��?��&3�s���j�����3~� pk mt�s\�|?��7com/storware/common/util/realtimechartcomposite$6.class��moa��{��v��p rŗq,��5��庴��;r�w����a� ?��8[0"����ٹ�������_��a������l<00�!�h�`�"�tc,dt��x�#�#�pm�;�}�/��tc{a��r��n�*��t˳ mae� �x���vz���e���zq(kmpg]ve���0�uw�@�b9�iw�� �cu{� 3���{%b�� ^d�m����l�lp_���2����~��a h���%5i�4��k㐢`���ҿ-vb�d�v ��v����� fы|[,k��{�c*%���)�� ^idž�il�hຉk��hg��i<�1cbs:����s�l,๎��el1t\�h'yw� ��h/7��r��uk��tܪ36cg ��g]�w� >�w��0�m��:2c=�v[ <�l ۑ;�����ړ���x�c�w��`qn�j���a�7 r�.���� ��*�t�6_� ኻ�)����\�b���$�jr�ߚlo����/k�����h,�d�w[04�1� w�52a�bk$t�4s�ҋ��׎��ir�� 4��#g`��#h��h8�v��d����mrw�9��j� iw��{��l��$k���{��j�h|�#��� vx�n�i;f�4)�2�� ,�?t�?��6�mmym9m��w��4�{q�pb�./.����b��k5zg��"#v��f���=ka��u�m�ͪ=��ʀem� ����s���hbq �e8�!���ke�c�yt3gas�)ӊ�ps�èy�%#룱6��֘a��2�?m.��� �;��� ��2#u� |m¿&��f$��fy �ֆ�c��q��=�[�t��ե�!��0�~u`u�d���ѯa���q#2� �:v1�7���a�4-�d�/��&{ ��3��jy�o4��4z���d<63f������|��-�q�9� ��e��b�p�bu�aet���c cf����my��j�-�pp}(b�(�< ���łxh�֠ �rnqy�v��hlm ��ш�  �� ��=o�u��񇁕�m�@x* ��$r�3�d���c!b�(ǥ���f0�f���a����8�l�y����'�1�w��d�������0 v�i1bbm���ys���x���y��ƕ�n{s�il�� �n����٩�st��0��n��.,isuc"���p�v�z�5ipfd�c��ԅ�x0��}i�� �j6����:y���]��ĕ����z�i������w��r$�}ԛkfhxj��ɺ��6l����5�}s�!f���~v���nv����u�d�",�\�^��΄�m޺�h]�2�l{h9u�7�t~erfad@��v,&gwv���������u�q�� ���'�zk���0���xe%��᎛�i�c6�ռ����ԙn�3��nc ���z�q���!?ftdw����h3�z�?��� ɲ=a�]k/�h=����*�-e�)��r��48�w�u���f���������ѯ�q]ç��ߛ��`�,�#ms�j8�g뿞����q��ڔ�b�}hi_碈��� �f<>��#,*9b�;��ӱ��^6��f�q���1uh4�è�)u�cޑ�8��r���=mh7��l?��ѯxи��0"3�c��m��������p���qǐ�c��� m<�i��t��kp���x#]h�7��,�[t܊�4�x�kh����s��o�r$x脒í��o h�u��.�h�n?� حh�]��ut�f?��|�ӵr�� &��~��u��d׳�h�t��t�q��d�ʹ�s��]!vx��w�u��q��s�n�[8}���mt�nwн�3�p�m�ڍ�n[�.!�;~fw�tm%l=��9νt�.[p��p��f��&���sz@����azh�_贍6�]���r����d�f��gq^:�tjr�n��!�� �j�g���n�� {�v4���gq���c�w�}b{?�j�_����� a�$u�eg�28����f����8�<�k9�r����izf�guz[���tn�:���}�^��%�� �^�����^�{p�\��g�q�n�����g�q:��{xg��k;�ytph �-�w�w��c���l)��9t7���\��b���3z%y�͘c�=$ b�d.�cvlɡrv*��� s�'u�3 ��zv��%��ǘ*�ʎ�}�)fsav3 �g>��|� 3�!�;��>��c�ܖ% j8��x@i���no�e�a�m�@��p0n��f ��l�iz,j�gfȓj�vi�1gl&��jhf*y]h~���u��� �^f���p�m%�[�cf�x�ƽx�e�/i�k��im���!�i_b�|i-��%����3z[�%�[?pt5as��hm9ed�޹��f��c��>���,�����z��l��t��zq3�.������y��rz�~l����a���ε�� j�2i�u2w��'���}��7�1qs!f$�y�,2s�b�0���jd���q��a��k��~�& //���!�kc�a�g��l���k� f�1$��ed\o�,�d<�b�� �k���l�b�gur�m^i��g���at����al���d��.��h0��b��5bq�xm�����a?�p"l��m�n���o\���x�x���3%������0z]ayg;r�fxk(.�h\\_�s%����5�}��� ��ÿ�93d8�g�ѱ�� l�� w|l]�5z�>��z���g��*��l�[�����j�!�xɨ;�kد�#�랯�{�]��ѽp��̯)e�=r*��``,.e7��rl���wp�ʴ�uܿ:��c��o6�槝�����mv�o8u��o��t�f��/;u���l�v�����'��溥��in��z���.di�"[ *-�w7�]�)u�kɯ��]ȕ�`)�j˒ȗm岪xv�\��4�!i ݮpl�r.�����yܪg!�d\�1kp�����4�‰��$p��;����,��>y�%t����?����9zp���%�q�ֽ�éz�q�����5e��c�.-� �c(�큯���γg�����9r �� ����2՟�dq���~���!��2�˹ǰ��`d3�q'12�b�5�n�����e�'1vxg%1n?ƌ$w"o&$1�lmjb���i�h�s�s��m��3֊86��dae���.� o�l2�l89it`z����ރ�i���b�oȓ$��'v�\r�;p\�r�@u3��'5����$nي�ns��i \;pj��<,�!3s;'8��}ns�ë\>w��n7���d2kln'ȕ�l� p��i� �z�<��/��59͙7��'qo�i�݉lku��[�r3�3��e��=�ei#k ��cg ���x,ƾ�y��r��9�bm��`iߕ &�=s�kesi,�z���v3yw�2��mԩ�ȇl��;?���p���l��l�ӹ}������n��v�g;��w��oĭ�&܃��}l�o��?���� ����`;����0 �n�]4i�duc7��:�r{)�}t��x���st#��;�݇i;^�g�2=�w�e�*����#�n�� ����ƛ��x�1�8�x�1v,������g� ��b���ë�&3��|__b -�b�j��vz7|��<>�c|w�|��x�>z�o�n��b< �/�ⵓ��5|��kl��4�h|�/1� thx�į��^1{{,����u�s�=pm7�9���m� a��?���9��<�[�c����e��%s�({��v)���}6ǫyb���۷�*��.�d? ���*��3�fy1��p@�𑮠�2�^��r� mp�6��4pypz�5��x�q�j����c^j�� �:�6�1�"�ry��"�tu7݂a��|����zw��ڊ9� k's�y�a�ry_�5��f{��続>��]$#�n�,-rkf��]�s x��x�h�#��}��26c �\��%lk�k�؀�� ���xja5�e?u:�a)��* �������)�kه^�k���p3����f?�or�����_�4��s1]dchm�n��et<]n�h#-� ������*���mt���n���lu����n�l�e��y�f��4ld��v5���gat�vy~�#���kn�v�k��ڀ�s��'_�?p r���x�[ne�5��| nië���?���3_c�_��/p8�t�f}���j�#3���u��cr�*�(��&e��ⲽ[0��huy�tӛ4n5t;%{(���^3b�z^ڌ��6j�b"݆)��s$k��| έ���ox%��$1�i��2i9k.\ޯᑣ �#������i�e)bt_f�i���o.����n�5����}d���y�9�ޥ� ��c����4}��o����� ��2�}�x?3~��rd����c i"�" m(g�uv�z��m�uф������]f�^z�,��^��x��x�upwp����ű��k�_(����ŝd w�%�el/�\�� �nsl�$��� �wo-i}�"��>t������b� ��_g {q�νe.n�o��am��ڣ��x���v�ķ�7��wn6��w�s��ܩ��������j�(��m��=�>d�}�*�u�!&[��g]��5��1nec��t��"�mk�r��<��^�z�����v�ts��� 't��9\�b�%�c�c�ۑ�#y���!�� e��cc�9��d��a3��6��l�x(�q���;x �a��~ܓ��(�`g���9*���i�jt9f��f�f��g�0q�h!���b� 8��_|j!�[:r��lib ε{�㶕��fm>�w��xjg� ��z��l��g}c���?��m}�������rƒ�/�e d�a���|����,����*��$��� _�k��, ��y��&�e��6i#�m����6p^�b�����h�����!û�%��3o&"g�����lnry��{������s �&�~�<%�'�,����� a�*�q�sy�������>ߪۭ�լ�pk mt�s}̚p�v1com/storware/common/util/remotecallutil$1$1.class�tkoa=c�� �����p���ey���hҥhb���v(kvg���gi"m��(��m@ �6;s���s��{�?}�`�$z0�b/�&����b�'0�b��a&�b��p�50gੁg ����g�3�`v��^��/}�b��.�� or:�z�v`;|k�:�e�8�阝 њ��`����a^~�!^� �p�j ���֥�-�y2um ggxvx�8�a� 3�'�ʋy-ek.$�v�f]�0�]�}�j�ڑ�e�-����esn�j�t˳�;,��2w�@ ��ke9ڷuss��a�9^�h����� i ,�x�j�ɥ�p���q�k��!�2c�m��͊��k�hze�v� �{��n(�x���5�3 ]ȳ՞�\�z�x�u��aj�a��a�#t���/m�ܵ�r�=���qi�$�a6��jdޡ� �]b���mkҽʈ����ii��ھ 9f����n4e��(� �s� ��*���8�du��zo�nr~-�h4 ���y���r�o�їa�a�_yt�aa���ׇ��/�`��� ���ӡ6�s�e��;d��coj��l� ]���;�vs h�wijg����1�=�p�#�q��w�>|f<=v��j!c|e��b&� �0w�i&��u�j]$�%�]$�e�*�2fh�y�^(c�sf����(*��c����2de������� pk mt�s�����a1com/storware/common/util/remotecallutil$1$2.class�tkoa=c��ky���-�./� (u�z4���t;�!�;�����d0���q�;[ �a���ss�9w�=�?�~0�b�n� # �⮁l1�:0�d��0с��-�l�20m`��=ܒa�<� f��_tx��!_��k��w�/,:�ʳ��t�5�p�㼣cfj���'��b�y� �xq����ě�[�:�:�i��͝ �k}>r�u� �'�lsy1��њմ�np��=��� �p���@9�jj�&���֪^kj�����m�,u1=�� �|��m^x����we��j&�ᾁzl��&�uazl<�#"t~��c9� vc����a3̸�����j6 n ����,��~�ڼ'��{�00gbol,`���d��>(����s,�x�%��ΐ� ��խ��ma�4�c�z��zc͝�@�p&�����7l�t�$� �zڂf7tv�w�$�$\�*[bs ��l����exqag�r҂?�8�d�k�d�'m'(�����l��a-�\�o�2�c߿�������!����(a�>!] ݂�rz��ei��}��'k��ړ�;d��(� ��<�uz�[q���@di4f��y���x5� ���o ���o_�q�d>���k����4�hкl���k�]!�q�"���o�1rtf'�n�6��(j� ��qtci���� ����pk mt�sy��ovs /com/storware/common/util/remotecallutil$1.class�vks�f=� !�c�!@ i��r ic�$`lb0$x�k_t�ȓg�!� �ii��t��?�ӻ�!��v����<{����ﯿ�­c;����3s ��č�r fk�\e/t�1w��zđq��`q�k�r��"��\*n`y���u-��,�9�xv��� ����g-�8�k����ϡ�q��oz§esf��q��n^7�r�� 5�c� -}g?��2ē�`h�x�x,6���7l!չ&�w�g��11l[dj0c��\o�{b�e�u�r`�zv�@$�m�в{�|���a�����u��cŽ��b����6r/7v ��y� �zo�-?�:"���� ��hb�u&y�^�i���^��x�c,��6�t�yv�]��w^��)>f\-'�:��������!������)��aɖ_�(l��v��a�#�,wd a$l̒� '�%��������� ��b֒;w��� ic��)ǵ]��aa��4��_4t�k�]�3��<ók��.� #��-��p�]�r�����k#�b�/�c����i_��;冹m� �n� 65lqh�~�12�<�����p��lr������ ���� �d�� ��z���vhw }�g迲"�ħi���󲒡���ٮ�[*2lw*e�- �>y�z?���i�dnjuj}&�y7r��tv}>�v��̤s��u��gw�h��y9q>$�y�wk���uɧ�'n�s3�q��g�hk�����0m�y��~��[�䤯�x~���j���k6%�=�n�h�ҡ�k\ �:�8f�0n��<[r�^!wc���»�qs`�.�pj�%�pѕ��.�$�������� �e�o��b7�5�|��p�� ���䁉4�j(�����`7���_{��7�i�}��wp3�m�b��?h8̼c�{$����#4 �;&�h�g�6i��c�{���p�k_���ҏ�n>f��h�c�%q{�1<#�il`sx�f?ԗ�� �5�j��0�a ��tߧ��4c:͖�a�����@� ķ<���qz%����u�i��#�^�g���o����'!�� �qre~����fmt;�sk�@ѓ���pk mt�st��p�-com/storware/common/util/remotecallutil.class�s[oa��-�vnr�. �*녷l0�.�� ��er����,��i$1>�s��3s�p �m��=�9�;ߞ�����7kx���xj#�e�4��`���h`řb�xe,�p%�g����j�e���zyk�r�1�2�p) "���~,����]ro0$s�c�� �w�u�n u�m��17����j��l�}i����h��=w¡�n���l�v�e��~��"����0�0<˹��;>znu ��=d���(�:�s��t�u���' �s"����(k��� ���pg��m[jme%��ի�:�����m�^v���fn����ot���4��a�<�\����o`լi�1ưtii��k���cc��"�� ��z��)c�*/�0��� �\��c�^���s�m��υ&�����?w��2���/lu�%��b&ry�wg�裟`��! ��(�q���=�qb�|��1�g[2a�߂��$;�-�n���&q&lsl(�øw��� ��d��@�1ܕ/�|gv��� ��t��uw�ƒ�t p�p&��1���i�3���yzz@h��e����e~pk mt�s_ɜr��,com/storware/common/util/renameproceed.class���n�0��m�b�߀���b���p6ǵ�uk�/�„���p�t�0��\�c���o�n1�c�a�adh�u��!�.�t/%ap�f�ں�斗�kƅ�zp��߄�}pk¤�fk��7�9s놵vu�z6��wf )�g���b�!�ѭ�r��_�ɋ?�.t��! =�*�ܳy���b���?�os�:��$7;g���p�9mc�ǎ����"w��o�(~�c�������pk mt�s���w .com/storware/common/util/selectbuttonbar.class�u�r�v]'v �$mں΅`��z���4-��hli.���'��,y��/��~dg��δq�����:�g�.��n�3粽�zko�#��ϟx�z'0����>r��*��>ձ���/�����j5,��w����k�0��'��y�[r>c�–%��dŠv���6[bfv��1l4������*�w�%x ڝ r���l>Ꮀ�]�#b=γf�|�7<�k� �j�d�v}qw��a�`���{ j�1tl'h[� � �6������y�8���2)�l�0�d�p� 2��f��� �/�a��6e�i��o���������sލ�����7��l9��r������**ױ��γ5�i[�t���`�����=ԇdv ���ٷߧm�����v��rs����m�� l���%�8i�����60�i���ҕi?�����[f8ш1�-�y:v \�u7ps�-��m�l�=��� ���=s�x�[ַ�m���wy=��ôūbv������g�'b��5e�%�͐sok���b�t���'���`�a��\���԰#�u���r��/i!z<,?8��񭝾��_�o6.�9x�n �їf��f��g�� �u�h$����#� ���0k� >�j�k��e㠈5��j0� =��n=\�q�kpk mt�s����-com/storware/common/util/storwarefilter.class]n� �@��ju?b]|�[ǂ :n��� �n���o~�%��bi���x�`#�1"lm�:c�9� �t��q\*{����l� w������v)���ʕ���y��d.�1z�ց0�]��lm)�y���6�_w����hk��rlɿq���а@�e�>�na�r�pk mt�s�3{�q0com/storware/common/util/storwarelistner$1.class�r]k�@=�d��m�m?�_i�[��-��/rd�pܖ�j|�&���lf�̶�-j���>��m"ޤ�a��̝{��snn��׷�c���up~�-9xvpg�|*i�3x��1��q�`�ue"���_�*s]���k��e�6�2��i"t'�i*(��j�f�s�e@�p%���8�ůl �4�2to�ő�14�]���c9je���@��ĥ� q���v3���w�e.��a����qa��sc��2k�r��-?�4��$�u*���09xq��5�p��h`��0�o��d�߾_d|d�fhޔ�a�/̡�/��o q���h��3�b��t�f� �p�5sgv�$�����*{&h�p�p�s@�q,���}ʯ 9 6p�ݽ` �fp ��ڢ����|�~����|@���\b���dy�� ��r�9rla khc ۹��u!��<̒p ��3or t-���y6e�vnw�)ڸ��d��r��pk mt�sbv�d��0com/storware/common/util/storwarelistner$2.class�s[oa��n��,�* h�"[ ]����t��l <��ldz��������hh|6ql|0>��ۥ���d��|�9�9g��׷�&0�a���c� d� ���a� �rqp1,���];|"������w�-ەk����_5�"7*�e:k�og�:��v ��]w�%� ��p�� ��}ӗ۞k솶c�����t���l�×��ou�?w���!-�� �쇆ܓn/��|���i�� ���x߮�$�w��ݩ �m���4�l�1�id��)�^�vgi�y%4��es��~f���-�`g��s�����k9^���2��*f4ahƞiũ���0�q�}��^����x�bj�cl ]������>��;��rw�p����<6���xf�[�t��u�c]�/)�@��0}ӊ�)u�&$^f��ڳ� �����ҋz��d5~$�5_?���v��`�5c���2f��o�n� |����29��s�n暊�i\㪝��)��p��|b�$e�� sz1�}y���>�-y���y��� �/h|do��$�f���v:�x �-c}d ��n��ir�域c%�����r��o:�m� "2������n��ݯ�?}џ�z�c�<�:r�k �@.���]rc��˸�c@�u�t\hr}7hlgf���,� �/���s2���(�2q�&ڰglj��8�]�&na��8&��$n�������g����)��@�} �zv�4�=�\ܟ[� <�-��v���:{靆�d��^`ǜ�fҙ���e�n��`�b�z��7:�\1��ԏퟀ��°gfqw__�j�oh��'�j<���<�fչh���t>��c=ڈ��w^�����h�]-�w�����ny��hnh[�� b���'��?�%��\y�禞k��>�͉��9�u:��y�֍e�̞��� �����g4�űl�1wc�v�a�!��v�%�w�ֈ4��g�u���5��f��'p�6���ha�e=e^�pϑ�,z�w��6�iu�(��.q dyim��{�q���*x�n���(c�0�c8n>zy��p��or/�o��qj���m�g�q&!�,�q��zg�� �n��i�pk mt�s����(0com/storware/common/util/storwarelistner$4.class�s�n�@=��q��$����;p��d7��debj� �pxm�!���d�$��@� �k|�k*���b�k�=s_������,��k(�f 7q��m w�)��2xm<�r���-��7�b&��k ��w�^�~(�ip���֚-0�c񩌤~���y���2z* ն���d�q��po ��]k�g��ʄ�~e"n��(u�$�� i����=<�sn�؋�p%2� =t������g�²��l��i��фk��o���e}7�c-bg^x���y>�h��ӎ7no�w���0}�a_�h��g�c|@�lc7齳w�=s��_�� -�p�&,�zh)ł�~ wqm��&�,4ㆉa# �x����81cèxr���d����$�@�_^��#>�s�p1t�?�#o�ׂi9�g�膋n,�h�g¡��0p���;��`ы%m;��v�~h5��yo�՞0��d�atv��{k�p�鈊d�l�ė�&h�"��|������������s��� ��5_��w��?�)�� w|���� ���i��o\ !v�i��ep�s���$z�i��errwa�/i%mtw���p�e)�`��'�����rw8o��(v s�]� w5є��l�� �m9mw�5b ��08u��`q�qܝ���u2�d��⮧�u��*�l�b��4���u���<`⦍s�q ���t]�1d�7�!�=)f��pv��ã_j��f�y�"�fc�ɪ ��yh��)�����sʓ=lwyf>��@�#-8b�a;�j֮pm�p ���3�vw�w�7��@k�g~7��� �"t�n�b��ɽh�ѝ��a�)���ӧ0i~ � m#d� c���t]�l�_�y���hi���r�� ����#�ni�&>m� ��*���fo��3�кϵ9���y�vrmh������ur9�tq� b�܄�l\`�m? ք��Ԫ%2ե�͏{nl����^�m۪("�im,*�x����>��`��<�^]q�r��s��ړ�_��*(��y��pk mt�s�cn���3com/storware/common/util/tableviewerbuilder$1.class��� 1�g�;=���� �o�(x��b�;�3gl ��w��|(1bi�;���=_��9��b����x�4�j>*��[tj��m y����d�ze�-�g{�&��_zw��e(kdu*-~9���1��rk���zhir�k �j��b2���ճz͐ �����ac�a�~pk mt�s��jn�lcom/storware/common/util/tableviewerbuilder$tableviewercontentprovider.class�s]oa=�[��.��q�q�!.�ր(�ؤ~$5}�i�ap���ζ�s��`�&}�g�n7����lf��;��9����?�~���r��c�ml`����&*&���>���a��};ԁ:u�����i��o��':r� �,�^o��h_�=�ne*d�c��=axhi_���]��d�r p��(�i0k$ܼ@��z��� ��i v��9�9a(8��4�6�&�: gb?�d��l�ui�8c����~�=�nt�cs�@qq����q߿ti�fo�� d˨�-��?���1�d�ь�ud ד�p�'�w��drh��7ə����s#a�ߜ����5c-l��45�� r�8�����>�o�0�9 y�����z2�j�j��xd8�?�gؽ��f[��ց�1����j9˕ɗ[�b!���̀ia�r�~�y��(��bo@�v� �}a�{��7�9� �l�gyx��x1��)�!�qv�� �g�����,�����3�1�"��l��h� ��s�2�y�'(zd�vӄ�<)����$\�h3���[)���?��k��s�5�n�� w�2ؾ�p�c1i���b �pk mt�s���/r� jcom/storware/common/util/tableviewerbuilder$tableviewerlabelprovider.class�vmsu~n�iؐ(�z��@"t[h��e��va�v[��%�����./�c��:z������&��ܛ�&p2�d���{�y�y������ `�i�q�-�$���$>ž$�$_��x�gi|���/4|�dey�������၆�4|�� t��p�ܚ���ozܠ������� s�曂�s�ޮ� ܛ'����t� ͉m�آ[� �p��nm�{j�![v-��4=!ߛ�1�"å�������'�a/9�m��9i�t���y�ı�ʃe�ޭ9��y%w�r�s�4lө��v�̗&ʮw5�e��� ?0��y*,�pj�h�b�����p�ӹ�k� $�s� �v����đ��ښy��j�'�*�����yլ z֩�4$����xg>�"��kv*e�ܑ�������6-n�p��� �h�!d�{ [e�u�'�9����h�{����ns�xh��c�>���=~lh�ó�*���q��l�e���r�!���z_�w�n mi�:pqg�����v�w:��c����u<� ?�0��0|~a3�w(i�:*��b����ѐ �����un�(��!@]e�!߅<�ǵ,����ij��.g壎�4,d����eub�p�y�̓r�4�u�99䀥��i�ch�8j��nw(ĺ��r��m��i(q:㊚�@�:��d�陮��@�� �������mn�\��i o�e2�q�s�@d� ��o�~@r2���w�����h�� �.a�<�r�� �3���&� �0�"�#v�x��5vx�v�?b�p���k\8��;b/;$��`� ���04�c��#�r`y������pn̒�1�{��ťɦ;��}\s.j)�����w�g�€��m� �i����t�hq__ ds�ϧ������2�n`�̡��� �i��#�p`�c�fh� !�k��n`�_l5 ̩|�铉[r&��!�ƙ��a�&d^�w�(�䞅���x4���:�_nh�*ͫ���x$d!��he���l��c�u��m�%��&��w�qfz���8qܤ�`���uc,(��x��,=����۴$2�pk mt�s ׋�� ecom/storware/common/util/tableviewerbuilder$tableviewermodifier.class�u[wu�vhf`$�b�v{��!���am�rk&:��3(o�_|hת���������>'! �ԓ嚵�u{�v��� `�0��ü�4���swq��uܐۛ:� �ba�-��g��l�s|���ce�*a�t��i�x� *v� �7���j��y���'j���͚�e8�� ���w �����%br>( �@���j��)b%h*���е��arr$�hs���-w�s��e8��q$x�f7\f:hd���w�}��\q�޵-����ۛ;‰��n������f7��de��t���[ ������ �~[�%۫����g��b�p�ŭg���n��]�zl;w�� �sxi�y�x&���d�v��b�w9�� ܶ���hx�^l��e�0jda ��p���a5��j�q�𠻊�*�s�s�ѥ�v�h���bg,��63g�&d�l�i�!����&�ě�u_���k��[��u�!]&��]���f��}|o�~��f7��(��"\���@hn87d;��-�֮be����f���u� =9�,���9v���w����cg ȣ �2���w�b�c�,%��2��b6��p�c�t���88���k�[=?p�e��r=�h�#�&��> i)�$�׼jm�y�"�\ڶ�(����(u��_]m����c ��p��혣����y-� �� ��i�}��l!!��o�r����/��d�z��.� �ˀ6�6�m��_g�x&�������#1�_!� ��m)w�����,����#f��~�}��l���x)��:�ǫ�u��c�n��zijh��&�t� ӗ2���a&r�l�@�e �$p�a�����2�a�9#u��_0f��do̦��&�l�9���h���l��x��ӳl�� ��g]c-��xz�<���s`�"��o��� �kls��$�k*e�gz�g��媠b�1f ��u?�3�g)��i$�� m��crǔ?���jip5�4^`�2xz�� թ��z�4|�uej�1>q�ti!/�]��'l ��<-��pk mt�s ��(ecom/storware/common/util/tableviewerbuilder$tableviewersorter$1.class�t[oa��-](�]�(�b��p�"�r.b�r)hr�o&�2���.�����|��1�|��l)j$�i�s��w�s�s���� ���c��3b=uh�` ���p�0"ݨ�1 �%�`h�q��fł�17��0�m݉$%�dhyu� ���]n�,��6��1mn� �q��0�լ�⸖���\�m�2����%�٢nlp;r��"����s �h�\��c mmpj.��|�xx�dh�z�j���.�gʀȗa�:ϑ$�!��6y3d�y�� \3�m� [u� ;�qjv�얺�*�j敷�[\s����u��zn�d��h��i� ����br����t��`�z��jc�u�o�궗��q�p�*���e�:*�3(���lͱ�^�!#� �h�!�af&elaz� 3�����s�d�<d,� �v9mg�ur�w����/�ޛ�yn�ɪ\14_-5�&�ݒ\�g3�/�|d�q��ibhܦ{ɼ�p�ouӹ�df��շ[�h�9e<|v]��;���k�%ne@ j�l{o�*�s����o�������u�bh�v"���s��v�>�2x�<��f1�4bc�6�cr��~z���`������a� v��þq��$ai�9����_��h]���#p��}?�c��xs���y�πf�ˆ�ka�z�i�pk mt�s�*x�[�xcom/storware/common/util/tableviewerbuilder$tableviewersorter$tableseletionadapter.class�v[o�j�&)qc �r)�)� �m�sj��@ �$����cj�i���r)��3� ��a��:-�tш(�zvv�ofgw����7��a��z�<б��d�5 �x��i� �qg�tl.�q�r:�ah�)b"���&����ve�u��(���g�v��0\��)3=�n���ɔ皵щ���gjn�"�l� <�nȑg� ��)�f�� ��� .צ� _��=۪�-ߑ�m&kب�%q��g*ִjube|2k�r�k�ner�r�e���=�vՙ��cs�7 �ȇ���\%hl{�2� k��8�uks.{xw -��5��i8mx��ҷ�ޯ�=�c?�lћ����o�s��ďf����o��ftx�mr:�a��(���z�h��#*��1�3p pq�%e��� �⚆�j�0p���~cqw��),�v����~�y����jz�����|��7՗!��-��|�g��6�s��� {[i@�~�m� � �����`��%�9s'|����p����v˻� 2�dz��~>( �[$�s=ܳla�(�`��� 9�wr�q�����y ���� � ��ŗ-(f�b�d��i~b)��g��8b�&�r�zzc��\�⹗h{γ��`�lcِ2tl����������ur���g��-sі�t��������mpqacamk� ����9ck�b{�~��ǟ�$$����#r�/��'��g\�� �ܧo*dwd�a\j]��r�����2�mg� cttp�6co#���*���kė.l��x�o`����e�*ony�q��#� �i����n�n�pk mt�s[u�p4� ccom/storware/common/util/tableviewerbuilder$tableviewersorter.class�wmou~ξmw:-ۗ������m��b �ʶ �e�u�{y�lg��l� q>a0~!ai�6f)f��gl� ƀ��n�k �mr_�y�s�9���{���� �g��怊1��ʓc*f񦊷0��m�mv�� *�ਊwpl.�ds\6�ʍi9:��=m8�������w���1u���'g;�pژe g�d��p ��hn��g����1�k� �#�r�@c��w�t��ټ=����t g�<��-��%�c�f� �!v�cz�7lhե��$df� �ɚ��(�l �$�f��q�4s΃ň�h�w���bʪ ����)ʉlbԫ�ِ���.�%s��[��y( ϭ�3�ӛr��?;n��� >�s8����`jc�����8c8�*��o����4�j�y��h�`k��9 �4���pɯ� 8��vgap��t�0� {w�@�-�]ϼ��5���:�>��2['�iϸ&���-�r� ���vs*����̳�g���ս�k|yy������e�¹�^׺��w��(r~1仒5]��*��e-s�b� �}����zɰ����i�z&ε��d*���p��b�exr����|� '̓�մ�b)��gj��3nω�]k���m��k};xud�q�y��*.&������,�h�:� 1�n��e��%�d��6b�;gzp�6(���>�fn[�3���9��2�y]cv��po�t���:�3�!�;b�p���h��zk{�� �d��q��0�?�[� �&�2s�4�l�*:�k~"�b}��0| �-ͧ kc�f�͠�i$��}�b?�7!t� �ӿx��:�\i?�1\x�u����we������kf�.�o���<�#�,�4�rg��ψ��m���v�xd� �y4�xk���vh�^�l�c��dda�ػ�̌��c_�c�n����4�u�;�{�[�� �g��oph��w�p�$�3�h�����}���-ӿ[���z�e����x;�l�j ���*�� və*����c�����!�s�!^�ka�'x&#��e��̺;h��e9�t�os��� o��.�|j�˽���co�n��/�ľ���ԇ�h�� �u�e:ge��a�]|$ߣ���߾��*2ʗn��"v��>��_[л�i4�pk mt�sq:xp� �1com/storware/common/util/tableviewerbuilder.class�xytt��}��%��� hj�d&0�,���m���ؗ�#y0�i�!��h5v���*-b ��� jj�����z����ў���t9� ���m&����9�c��~�����}s���>���ga��<��ý�<���x�)��= vyp/v �� �vp�9� o>����<<��cl�s|�0�a"{|ރbܥ� �ãl�~�p�e&�k >ȫcl�� {0g��q>����*�/���c<<��q�m�o(8�a�%ۇ'|s��je8�g b�i���:�)��z���d-=*����4[ ��@��&=�.�n4��ĕ��h���������&q)�cg����z-�dta�5�y�!�m ��q���`�h7���-zpl�gf ��b�l�gx��x��l �тz�6m�p@"t��*"�x[x���eg�������'��a^)� 2��j�m@clp_g� k����a�� �a4������gl��w^��:#1 �:j4��,mqy���"ҭ ��2�zm��i�jy�we�z�^��o�v�a���$1���qy�ٚ�� -l l��.��ܚij���*"���xd��f���p�ڪm׈h�%��i���,.#���wӡe���k� �fn���uk�@5l� ',�)c�u��uvz6��*0�s4��6�� �/ �j�v=js�ۘ�}�5�-�la=z�li*�[�d\�_@��εl���*��d��dl*� zl�r@�w�.�/ޅ��v=��=2����vr�#k#��`p7͒��g l.u���f�=��fy?j�#�~.�d����h,�w�nw]lr{v�? )t��*��˰\e%�y�q�k�r�-�c:4wk��vыo l����s�f!^ɥ�c�֧�i<��;�.�����gu���f�*>�0���ˋjg��/m��pkѝ�v�k���u��y�蜊�"=8ik�m����������%?�� ��<���i�\� ���_�w�ck�@�hj��_�x��5��7�_�x�ݗ���wk���ݗ��=�rʮd�!���z�/����u�7t`rzos,�;�n0b�ect����2�`�$}�a�d��x(d��q��ȏa/��;�a�a��#j�ՠa�p �12����q�c�2�ީ���@i�b9]����ȿc��a��j����\گ�5�vo����n`�c�v3y�6̺h,�a�^�h�*"�� �*�lm�0gkn��m�қ�fpd�b��e�_�4�a�b�`ô1 �n��� d�id%���k�s���.@f�\2grȕ2 ����6��k�ww�����ƕ�m:�qt����j�62n����u)�ca�0�#�c��%l_���`e��woy�lj��xv��u�ɡ�>���ǥ/��"�-�o]\g�%)����nb����ً������c��à��j��i���ᆓ�>�l!z�zb�vi� [�մ�٘��z@���f�ë��g�\բ�c}��f<\4g3�s8&�1�d���d��d��d��`� v�)����a:�����'����c��q��2g���u�(w���k������"�׋�fqt�|�^�4�1q£m���^��8�y��8��1ox���et� ���p��#��uh}�o��$�j2lơy؄b܁"܉)��t܍����m��� ��q?5x` d;�v<�[��n=��8 m���;i�������nڮ;a;^5�f��f�b#6��6��wi��m >,lvp����;��@c��lx9@3�r��ǔ�uk�)�j#$��0ڗ3r>�������j���7�(l쁷ڱt��� ��bb���8�׃�8&�brc�#�n@���s�(�r���k����~r��f_ �� �،8�9�:8�l�@��t�a��k��d��i{����f,r�t���x��w3z��i�|7�(������k��t�u�|�_��p*�rp�̢��j/]��$j�,��yz��9j}_�kx�n��x ����&�x���b��@&ʕ��7m��d�f��j�ctd �g�� ɘ� ���,��6�( ,܋6�m�����:�ba�6�� !�ކ�&(�(h'h�[(k�k"zˈ �nпh����*2iv��fl��%c�>r��$a��c�� ���k�u&�g�u�|�� ��2�qx�{s� ������h���th��(�ci�-�x�hl�dq� �&���t�����#o�s��"{�� ��fo��m�a/�"&ퟍ�oh�rk�΢*�]�7[x�<b���dn7�w���$o�&u�cs��a��ɬ��������o�'���1��t�s���a�r�֜�2��trn���ҽ���?�?pk mt�s}>���)2com/storware/common/util/tableviewersorter$1.class�t�oa��v������x�쵂?���@ҥ�*>�h�� ��;������� �������d��w�5ڶ������o�۝���~0���� ����x71�!��ar��sjl븅�z�� �r� ����l�53��hx����|ϭk�5�[�._sx���/$s7�x�\��2�n�1ċ~�3$ˎǟ�k�\�~ �e߶�5k8jo� �q�<.����\i� ����t���p�ےw� ��/�ln��n�͠!m��=����{�j!32ѧ?c�]��e߭�<�.��"-�ͪ��,k��ua�g)�-�s;֞e=z�l�ok��m�j�6f{���c�@ 3f ��]��ӆd� ����{�o��ü�,jxd�1� <1?� կ��o�j�/�& ��8b:�q���{:�q) ���|���$q�*�!q��3���m��e�<����������/���ş��ڲ��:ǽu���ka�' �1�)� ��%o c�0����� a4"#�4�zi��tj�\zuѓ�9z��z$]y���'te?#�1�9o��|� ���p�p�v���!\j��1��}tm�#�gн��/іs�p�4q�߰�fo!r�q��$����i�����g������[�x��u�� �b���� \�j��3j~������_�e�}-���uz���� ��a�pk mt�s�g��2com/storware/common/util/tableviewersorter$2.class�t[oa���]z(`q�"vh�ekat�(65nrф >��ݎeq�kv��g�o$������d<�m�p"6ٝ9s�;߹̙�y���%�#� � �(���b����|22�radvģ�%���j$4�h�mŭ�}�0��$2 �eͪˎk�{��ez�-sn��!�պ��t���e��αݪn��c&ً���b�*�����7� �} �h��tck�uo�v��$�4��7t�ᴜ��k"k��%(��,zvm暡�:\�y�j\n�xgn��;js� լ�o*;\soѥ���&��d�/�.&o'kdφz? )��n�r�]����n*%w�^n��~�"n1dkv���#ݫ�xw-�=f�}�� �!� �n[u�n㎄ j�$aw%� 'bu�=����x af�n��s�ҳ2�q/��0uv�zp��ɋ0���%\�n˰��i*�3��߃i�s���q�id3tc��������z��s�j�u��\o� �b޿�e��2l'�;�r>��"��q���n��������rw0a�t�^�@,�5@3u���10 ���u�ӥg�җha��q p�q����h�/y����<.� �hs!� � b�4�!�j����� ���ß!, �=q�^�/.@� �;" �a� d� �-����~h�[ύc*`�� ���~�\!)h�,��1m�8a�x�p��#`���a]� �]� ~!n��ni�i������pk mt�sd�ϡq2com/storware/common/util/tableviewersorter$3.class�u[oe��^יִ-v . ��4�s�\��m p���΅:��"��l� ��hws�x��7t�^�h)�t*�ďa��٤ц"xzϝۜ�7���y��p9�l�e�s�cz�/��kr9%��rq�c��,�� �mǯ���� �`el30�aov��:�0�rþ'a��d�"��f��֒��ų'�d��dd3t�x�,�d�����2�� w%��1���h2n���/;�'�]�&3d0� q�w�x;�g��4%��d�l�z ���p}o=��u�֦�����lk��t,� ��bgm��c$���é�}2dĥ,r�'��"g��{ф�d^н�ӓ����0��0���%��5� =�n��9g]!��`���w �p#r�eob|dd�2�� ���;'��p��5��4qd��!��(������ �ܻ�>�i���5���0��7cv>ut�ܓ򻭂�pf\�$�ev�cb&-,y���ngϝ�ԇ� ��:��m8%m2�1��wj�w=��ur�fv�p\}d'�ez�`�q)�]i����-�mk`��f�q0����b�l��|�8o��[�5b4��v f~�d�@"��0�����v����4���:#z&c�����f���|�� k�s�qjh�rh~bʮ� %�r���m��u7��e*k�o�鶊���ה�y3�f�>�kh�j ӱ4��: q4ˡu`����>��j�0 �ѧyy���b hx�hx�r˷i]���>�v�e|ć>�% � �j��ᲆ��/qe~•�w����x>����j�u]v: ��y�k�hq=(y�sf�.ݞ��!jqծ��=[7\�] @�u�;��2gódz/v/�wd�΍�rפ�q�s��k�g�b�u��m�5b�/j�<����]���;߾lxï���� ��x�o�u�y���5o��}g�ل�̎�f�'��ƒ���n'�����e�i���w�p6sus"c ��ӊ�&�jxsi�x����c .��'�<�e�x��a���o���8b�#�k�"�h���!�h�b8���i�[}վ�������վ��/����$v�º�8��=�0.�7��d�u�-]t�:���{�"zi�a�����<9�ӝ �rvn�]x�:�'m���ߵx���=���� ��y����1uy��� a��!����d���:ek� z��iz�b���~�m�&�ǡ�g�q�q�8^��ܿ�̭cp$��1m� ��c��w� q�^�liqш�5!d�۰�*y��?�^ �#, �mg�w�e7�m ���8;�2l1�e4�أ�!0�� �_�y����[�j���:*����n�h���\�!���$�b�ci�"��䪮�ݞ���a�.���*��ƀ\!я��_3y�ah�e�;��a�8�q���d�d0gi��f�h%}��a�/��k� 3�`7���om=bt����ua� `��;���g]r��{ᡈ�xսyw2 m����{xڙ�yz��q���.�n�$��^c��}��^�d�δ}���ɏ��ȴ ;���� �p�uj�v"`�q ���foy���,̞���g2���f�}�a�������_�;w���pk mt�ss���: -com/storware/common/util/taskwithresult.class�vk[e~'�$ۦbek"�6j�b[i j �&)h�.��l�����_ԯ��v�~�g���$o��s��{.sι����o�x����x ��$�o%wn�.�sx�g ��j k�/��i���`3� �>h"-�� ����ji;-c`��x{��}�l�u��}�1,/_� ���gi��=�]�� %�(��66}o@� 8�뷸 �[�����yl��q�s4-� lf�hmfk v� ']1-c�o�n=<�p��ٶ4ǔ�0�5mw`�������΁�4�n�v訮�o�m�y "e<#�v~�?�5^#g�ȟq��*�gx�n�.ggze �� �w=�!,�����en�w-�p�3��tc�3m� �3��g��k�i����: k��id̠���~�m�f8om]����6�ho��`���~�g�p�4�ɺ��'h�:o��}��!kp�/�?��^ n�l�эs{������m�t 㲊7�����l��� @ŗx�� _�f��[|��{hc�ˤb9�����>w�h�} p�i�?om��)����zӱ� 5��4���e�5�i4�eh��ݒתo7w5���m��t��r���=5�-�@]_�tvk��͍��s��#�|�x��kg {�)��{ ��ڰ��u%�b���wl� �h��t��1��j��x��f8���^>�_%r��gɏq�s#m�~��;d$�y����8�`{��8��"]f(�p�j\m���t�$yf��:f�3m��wby�j�'j,�3�?� �l1����;�'�$�qh>�������p�@e��#�p"x�͑����c$bx���!���q�� �9qrv[�.v�&��r�,���wb�� o�a(���� ���y�]���?ik��kz�s#�.���x�쁇���u �_��y�"�߻�s�hk�c 7q��%��uq 5��v�� �)�%u�q��h'�1��/� r���j�v���cw�����d��n)½��-p5��� 6���f"���!�"g!edx�"c���pk mt�s��ta� �-com/storware/common/util/unitsconverter.class�wkxw�fw2��,��$�@hhih�()w�r�dca�d7ɒݝ�݄kkk�z�e�ekkk ��v�e x ���zo��_��>�����z��9;��l|��ٙs����n�2���d��>t�3*�g�t��؟p�!�a�"ޠunz�c��w�t�c/�w��e}�c��������լv��!�^�$�=�7���\�]��������y��e?r�y���2]���u�=^r�e&���~�e�,{��m��}�=���gnzez{h�s�57��m)�c�rio0�@b��{�@�f���sә���ns��q�������][ r��hg�i�v��el �{6g�g�� �8!�hz�h'�krl��� ��x�h�7>uz�����>%�mi�>���df��}j*�ɪ#���x����f��v�g��x|$y ��a%=����xtmq��) n\оgsbi ���#�������n�;�鳦4:�m�yl9�~��::�� �h�f�l�_i)yf� ����7ԡ k>��@e�mp!��������am�@6u�q��ڍ��v[��v�|�y��a�u�fd!�nx��0�ٸw�w�����)��r`s �����~-9b������l�%ޗh)�v-�psz}��u  mqg�1�t`���>u �n 8�b��$p3��䊺c�v�����8�-{���^a,1�p89l���� q�!f-k �d,���ok�n�:�&20q-�6�h�i���f4mdi ��֑z��ʤ�y<.��l��hf�jb•�2ωz��p�� ��g�/�!н����ta��˲uրt��u�^z�~�4��`�y�uz�ko�/� 3�z����ko�i/��_y�m�5k!��s�#�]sws������lx�e���o頗~g�g��f��:��1�px4��1�ߥ�`bg������gty�9xf$�֘g�"p]^��%�`�3j2�����d��?��lnjmpr]ۖ�4�fұ���~��m�e���p蒠�����;f�r�{ۭy�7е��a�0�l�ơ��l�����u���8�2�l�xep�=�a��̖��h�2<oc��m�������� }wvͥ�8h�ƃ(d *�f ��n��4��b�g���_��s?��&s��n�2��i�x�xvc�[`׌�w�qis�jf0�lڊ�ww�m�o��@=�d! =d���so��w^�,ƶ�̞{�ij5�hjh�sm��s���p�u��)d����fz��2��;nӗ�e�y�|�u*�q��t�}�f\d���7 t�)�fei���b�� vjn�� �uv�m&u�n���ka�h�7�� �a{;l�ڱ��6��"�pƨi�ɣ�y�-�o��$n}>��zļ�����b�;.smg]�8�yw;n� s���s0�,���ۋx�o�2�1��bڇ�9�3��a��t�� t…��� /�/�2�����/�w�k o?cյh�p�-�bu�q��7�sh�w��h }򌮥�i}nbk��2�✼l��*j��5x�*by��^��ul�o�������ɯa�ǵ�ӗ�·6���.em��fλ�љ n~1}_���)(��u�"��3t�jj�����/�~�c����%���y�8 h��w��oi�s��ü��x���wu:��%��4��� �����|x�}�1k}=2�•k�np9�����g�_����>f��u3l)h$h��͖�ބ3���� �3���,'渴����%�m�5��#�#f�o�n�\�zz���pk mt�s"k� 0com/storware/common/util/userpasswordcheck.class�s�nq]�3�p�����:�x����hzd h|1�0�h�!�ac��_�u����(��?�o xyg���i�>�r�z{�3?~�`�8zq*�^�� ��<�q���8-�8 �@�8/�>6\�ܿs������ҍ�[�ĉ@|=rv�1 )�u�p2�i��l[m%�n��צ,wܘ�ҳ��fu�pmin՛��%ө� �q ��iԝ�>��u}�a�cf�����y�|:( �n��q3�,��q�, $*�a>-s@l���ϩ���*lr����5� z�)�v<ש��͔�� �j�gt:��̠��4���.vy��v(>�@�u��f�?�0m��y ��8�iݴ%�};����r�� qi������ё��э�0�hh�@����@j����'��mq��ív�����gln{�[`���i 5���"�������nz:���b|�!�� 8�=��z�bu\6\~�l�k��ߣ5���a��n ��czaz�o=�m�bm��9�(e�yr<�4��.��ёùm�}�����(�d�<8��t�{��r� ��5��|��k!����!�������wh�s��y\��� �h�g>�\��9��,�/�����%�v(�� �\��w����ۀs^)� ��"�j�����=���/p�~u�-#��b�pc�]h�s��q�,�slm��g��o���)&��")v!� k���:ɍ�/#�ܶ��[�ү�r�=�������b�%��7$�*i��n��&h�y!�pk mt�s䲸�c&com/storware/common/util/visitor.class��[s�p��� j�u@� p���� ^@a-u�2<����ir���3�� �>8>�i� ���9m u��}ȟ���ߞ�=���_���g1h��!�l m0b�*v�p]�ʠ̹뜡#k;0�w��n�a���q^����湷˽ 7y�%�j"�tt ��6�ºpdm?`8�g��]�t�y�3��^�4i�q�䞮�;��pq�-p�h�r(�p �[3>c_u��v�ݛ��0�|fj!z���ce��.���!pd� `����2����w��_�k�=*ӻ$wĩ�����p.�j ��r�h��_pt$dtv� ��1�f"����\l��he.rr7�pk mt�sb�����3com/storware/common/viewer/storwaretreeviewer.class���nqƿ)����`���b�x���&&mo �zَph��9{�ᱼ"��sή�t��'�vf2��ov���o�ޣ]e^�{ixٌ��i�|�#�ۯzƞ(n�z���&nm���]�:&�l;��'�;f���������q|<��j�$�[��xv�:#�^br�9c'�e%ijf�b�:,�g��j�bl,��#�����s�]�>s��u ��s�l����и����x�wn�p � /o�w���|s�z����csn�������g�e\c�/�^vk��ex�_߁��o;g_ℋ��я���]?��l�&����w�݉ޓ�%9@ew� �u����pm��&�ktϻpã@�`k����ŝ ��۸bi֒�v�m�m�aq��c�h�ǯ�dqn��-wfx\ã`����x�i�ֻ��xxo�̳�pk mt�s�-=,� &&com/storware/console/consolespec.class�xy`u��d�ٝ���i�=ӵ@�&kk ��"���n�b �e��f�l��.3�=p�*\�v��a��rش�� ފ(���x r��73��&�y����w����͓o?�8���8��@v�x�� >��3*ʰӏ;���~�)�w���n��^��~?��d�-yu�� >��������*��/�x���/�8��u�g$9�ǐ�����!�~t� sq �<�/��'$��r8�� *��u��kr���o�h�7���d����h'v�œr���}7����r����8�5�g~�x~��ou<�����ґ_��a<�g��~-�����r���ߝ ~ �kyɔ@ut��e�d�f<���j���&pn�}�-05��9��ߥ���1�z:c ǟx��z�/ғ��d_[4i�e�x�l�f�ޚ��yz�ߌّn��m�t��l����u����d/�o�� �;3�ѱ��㤄�ɘ�p�l����t�i{k���@�n'���edbʉ���v�ۓ2bt�3ҟ����on�xͺ��.��*���������1p�r��js,6fu�$���[��k�zq��1n����(3]q5�b#�*,c�m�� ��_'��m�����.ŏ����9/���� h���c�tkg����e�:w�v�2ijɗ��섑�\p~�r'm�-&.a��f�:f� όnʤz���ļx(�g�n��'�o9�2���4�>s���k�δġou�3�\ݱ-f���|��8k��ȑҩm&�f�m�xb�obg"m 3�svh��sd{�;���%܌�̀]�ci#�f���v��f�eqq�ey�����c�k� e�ʹ��xz_�g���"�eǿ ��җ�{!�=ɍ3܄v�s��a ��p.vix��掂�;��i� ������2f�נ���f �&��f��yc�5�d�fs2��15�ho��?�e���j�^s�g ��ev�e������&�� v��)`��x��z�wn���>����o���y�h����mvjyÿ�o������mi���vf�=�, ]��4�m�q�������&j���1?ƒ�ū�2q.��^5����cí����hui"��(�s���m�pe�p ַ4��i���5q)����os�4vbq`k�jf���grx��.�d�"fh",f2�b�&f�9�� �)���y�'b5q �/�4|� ��s�uc"vn�7nf h#7nuтd�_b̩�j�^��wխ<|;�^rdᴺ�m���d�y� �g ����q]�m�wt ���49^�զ� ����,�d��(�jl�vx�g����%�ywq��,#�c�u׵�u����hrw.�pa���f�5v�u�|�b��8;�}�"�����&����5@��l��vo"�:�; ��nט]�꺢��8��gt�g��xr�nw%-�#n ���� c[�[������d4�հ�u����u�|�-ufo��n���e���l�q}�����e9jԍi����mܸ�6��d΄�)�r��"��k�|�����(o{2�lz1��o}�w� �f7�/�sχ,7t ��#��?3k��gg����v����o���w�[�0��9�ñ�!.�z��{�b~��1��?ok���pґeit4���a���l��cj~��cy�c>ѹ�,���-��l��&�9*�]�x� ��q.�l���ja��khʥ9s6�c����ť�g����c��� &��9�:p�"ok��u�,\�h �r螞k<��<�j �r����y=��x�af��rodhg�/�fg�^�л��� z� }�5%�q����c�v��cuytw6wf��.����%��ey��n�bv�/쫜��얲�����24� 涖��c�iu���-�җ@u��� u�%tj�.lf�zg=��av���g�.� �*�b�#��nq$i�].�~���$>ǹ���q��p`'��a5��èo ��y4d�����"ss�^�^�/����*��x)w:�����e3���8&�q�!γ�l�'�sx��՜�@7` n�6��v����}��'�e�ǵ�y���k� ^��x�/@����b��s����vlf˩o15� �����m&�f�'���8�v��݃�i��&��,@ݕ�`c�����e�r��-<�����h,��x@3��6o-ń�~�q:e��:�hs9����p�@9j�u���;�5�3�v0��g�t>v��{=gi��(�oaj��q uk�i1�'����%p"��iy,�f�j����� �q{^%�q��x�p_owo���o�ޘs� oh9]�����ch؅399e0��v��e���j�b�nhm��9م���a�����:igd�u�g�晴f63�� ɲ��]���q�{��{y��� ��k�>^���jph � �^�]�����q*���*c>��й��;֥|� �*���l����"g��@ui^����j�{�x#����c8k`u�!��@�89["�e���w�3 f���f/�q�~���8w�k�g����m�[=$pr��ۦ���ljtrl��0v�@�� ��zz�l�'p|�pk mt�s=���m &com/storware/console/productspec.class�vmste���,�d��/)�ez�����"�.j�a�y8pس�=�k��ee��4���>�l�lix45m�~a?�mv=g7�$�`�y���z��z�������00p�z �a����4 ��@�u$���>���1�4��x��0�qlc"��hj�atb@c*��2�� �.��rc\��p&��n�iz�f�2ψ��9�v&4�al@6/�nh8��@ �:��q��y���t=kf� ��җ�k���a���8i)�$j����t��͕ʨ�0�aӵլ��ƭ���h™�d=�=i�2�p�yǖ*n2��b�`��q�"��x�d���h�s�������kb�v��*��#��g&&žk *\i&�/*��~!h �5�sp�l"�;�;2�� !�7e���r7������ \)�^w-x��y��g|ҝtgl�]����tj�dr? �r����9uu'��j�޺ �x}�7&p���� @���m�d��� ��tbf<�is�������ƌ�)hʘ ��gg�.�(srn����;ъ`�hf��f4�x[�����v�c�=���x�θ��,;�x,��i��0����%��dv�h;��rr�a� wf}<�:�� n� :^e��~'k:�c��c��ne��@�sg��>�x��e�%"�k\@�&�#��x��h��,�*p��e�m g��}�q�e\j��5x���?��x�}�� �3tv��\gq�4���� ��"04��� j*�i���,e3�� �~j��&�~�j:ф���.[d�\�w�'��}���#�'���-�"�6l�c�`)wo�� ݄^<5��먘�vk��f��g�n�e%�u�j� �۴�me��;��-� k7ps�3t4ocu�4>t<լwo��߬�p�s���s[p��ܹ��s注s�״�fa0��oqd�j��:լ��_%d��x���s�~��ύa���sj3-�a)�( (d�=$i�r3ijq��d�l2�̄r�� �]q�][,��?�������ɝv������{�=�̹������]�5�s���: �� �@# 6iv���}-0 �����!��p3��m���q� �$o>��3<<��s<��y�^��(�<�d�2����k�����<#|��� ���]��xx��8'o��an��!m?��c�o�)m�d,/źùp6�� �� �em��e�6�jyz�h�l� �����.��sa� d�))�p���xc|6��n�n6m��9��w�;�n6�p2��0)�#e�i&�q$�%��`$\hb2��c��j���7����s,~kd�z�\�s�vsx� 3���e#�(�s0� la�™������$�o��x��y����l��ý���f���h,�jwz��q����սn�^d���.��<��g�� g]�3x�dl�1���l��ѓh� ��"8�}a�r0��3�ho$� _��{ui��4[ꓲ������%�ò����n e vtaw���tt����h"ke�;b}^���mժjo�`��e9#zq�`jb�*�z�_1�r��p��y�ɦj�����jq0/q� �e��l*b{j�q��i���v ۩e�kfa�p)�^!�z���(� �¹��.�w�_z!��t���l�����l��7p�"\�[�n�ͤm�!lc���i� ����y�� j~�g� 5����hn|w�����7!-�e,b�b���q�(��1��c��*�1v�t`-k��rڰu�z#����wl :�di�rѱv����hd�h��kɺ�by�i �ۑ s/� v}�~�����1�m֐����t$u��t ٲ���y��q�4�t��d�ɩ�%w���4 ��۩����6�`� j��s�h�r������{i�6~����j,k�)jԕ���v�ʫ_�[�z9��x�\ˊ�/��rasi� �v�ǫl't��s�![6c僘�#�4�!rr���zݲce�v]4��t-�.��ϭ��,ϳ5t�>zӄ�es�҉��4(v�ak�v( �j�,�{e��k���֮\y'!��sio�-y�p �ײa(�"&�t��߲ ��x�y[�k��.���.��ʾ�jz�{� ����)����@��p*��xjݦn(�=������x�?�����e0�.=��қ��f��nf���v�a��ff�v rљ��b����wxxy��ky�4�n�y��%�y�a���^�;=��.�����n����g~������_�a��°i�p���p���0&��8v������@×�vu�q�8 u0�n�f0��������0��<4������4 �a�q��3�2 sz/� \ɡ�jmwr��s��㜯���p�s��,��߮px���k8�ՠ���i#0�e�� '��z�hrm3'�f���~�},�v��s�v�o�뷶����v�o��om���v�k����>l��.p��~�:w�ޯ/r�ŗ���z��\��˂7beg�&v�]� �ru�_���l�|����k c���1�*�׸�-~}���:�q{����w������g�f�k��>��a��w�|���۹���c���a��r�u��^���a8��'�?�tc>j��.�swk�pk mt�sl�"�q  com/storware/ha/rpc/hadtbusinessstate.class���j�p���&�mӌ���bb��,t��p e-�'�`oi�e��rq>�%τ7n�vf��|~�8ʀ �2 ��i[x��nac`)vi��'p��d�*i�l=��p�g���h����z�s�m6�t<�^@�f?�e0���|q4ұn��~4u�4��e�ܱt�g߽�����b'f��c{e���4s�:'�i:�qq`�䠌��޿t<�2|po����筼�#w���~���k�2a7@�, �%k�� �u(;"/ț�7����j�&� �q�̛pg#g�x^h�΀�� ��� �t� �� p�5e��|l���yě�͜�� pk mt�s�֣�l)com/storware/ha/rpc/hadtenablestate.class���n�p����b���wc�,�bw7^" ���塞�!�5�h�[� &.|�8shh\��ۙ��9������.lԋ��&f����m[��d�'aj���#�u'u��s��o��e���j�d�n2�� ̈́z;t�s��|^�ҁ�a<��i���d��'ρ���� �3��h�d��ē$�7f�?}�c��<�(ypp�pd�p�buf�peo�}��q= ���h^=4oҏ}>� �=rly�/h��^*�����=������y����;�p�ț5��j�r�2���3q���b�]q��0t:��egw̠��ٖ4y��q7$�2�\�ސz2 h�히)�з�� c���(��_�.f���(����& va�&�1������~pg��0ts*�ч5��m�e����}62�dk�b�9�d�f:�kt�рs�z`vk�j����w�߉�p&<"]�f/�ՠ�&��>�ֺb�fʗ��r��ly������/pk mt�s�ɛq2�,com/storware/ha/rpc/hadthafailoverinfo.class�r�n�@=�8q�j���>��-���xlzu ��db7�&�ڕ=n%�|,,$���~ ���wb�/�93�s�w���ov��p��$&���b�dh3t<�-�.�����d��d%���7�}�r`j/�r##s"�luf7�?>���\���4 eu)�l�0�ri�h��o�q��ff%w2���bgt�֥�rջ�& �ef�:>��;�lp�t`��q_����k�((��2��~�p� ��a��nt?%;�t�� �r�s"��ŧ�c�hg�uv1pi_bڙ=��rr��.63�t����e�e��v�~��m�zq��@s��?3�䕬cku��lw m�9�y�{xh��_�\��2:��#����ұ߳����(��^e tg� ul���7u� )�dz� ˍ���<_0��gwd�l�'ă��}��d�ֈaa����m�e�6n�"'��9�����-�({ 9��䔹y�q��������]�e �r9x%�fͭs;d�e�6i������z\���� �����!���18v� *v�(�v�0\:�j���pk mt�so��k��&com/storware/ha/rpc/hadthaifinfo.class�qmo�@��7""�x��ao/c���v\rz�m�w���?��v%�ĩ�������˾���8�fy���`]ce�f�j9� v$�a�5�� e�wۉ�q��0�w�xt9�#��j�"�f�zˏ��]���v�j�mq��n��fod$�sbzg��6g�5�,�d�`/p� �q싰 ���饕��;���&m�6�m�fg;?�{�ӂ �x���bj���z��<l� o��y6�[��!,~��� ?!͕��v�[��q/�d�ҍl��e��0�1�����|:d&�� z2�k�f� ,se6ae#5�թ@ȝsq 8{���ig�k�ij@�;k����0����t[w:8�jgo�j��k����pk mt�sqea�%com/storware/ha/rpc/hadthaiftip.class���n�@���ˆva����h7�4&fc ]@t�j(�%�j��wrall�|(㙱 /$n�s�����3�����=l� �e�%��8��q�u�s�±ʱʊ���s�qr���v[� ���m�3de������ �gb�>b� r���δ��d�ㄎc��&�st:�g`:� �篈�a�1��ۧis�&�����9�@��l�9m��|~��q�i ��#�_��w��ao#�����oi�%p�x���e ]t6:���c:skft�u�� �pk mt�s���ib%com/storware/ha/rpc/hadthaoppip.class���n�@����j���o��нƍ�hbd!q9� )ms�&�� b���c�o �����?3}�xyp�=ji�p6p1�-������ �plgn��z i?zc�=��v�7��q(��u�kof z�ϡ_���!ӗ���m"�� ԰�p��c��uq�fr�po;�ğf~��ca���}ïz7���i��h��w�fן���� ��6t��-l`�b&�����a�����x8�0��$}� �j�|r7b����di��)�bː�pvb��o6`��q��i؆�<�(��m�q 1 ���i� ь͑h�b�[@����h�@�"-u"f������rp�z�őz\�]�i�opk mt�s��qy"com/storware/ha/rpc/hadtifip.class}�_ka��͵i[����7�h_z �0ja��(��q�jdw�u5�[�ap��y�!�x�;�2�ww>��>�b3 �%�e��&q0eu`m`]`��t�y�k�:aj���p���m��]���q��� �0p��<��{��}�耐(o]�������=ƶ��b�:<�7� ;�2t� ��a��-�b�r��o �n�~�z'ʀ3?❶hd ſͫ�qu��h��0���4l)� k��%�s�#�{���\��#�����'��� xߘ��h~*2>�7��5��a��� �"ޑx��_��e�k #l�f����1c3���ye��b�� ���_�<���bp�%ydq(!��d��dr�� 1e�pk mt�s��lȋ� com/storware/ha/rpc/hadtip.classurmo�@�'�j��~�onz�=�mcb4f���r6�-)uo�%�ă?�e|�4�`�̼�};3�����'�4�x.`�� ��l��ذ�i(��i���ӄ0��'�etpcew�'��=����4��;;����tzl�mm��ӹ 喊���#���km�� �����ޫa�ƃ`��ɳhdp/�d��9��[���4���iǐi(ϕ�/n$����2*. p\5��uq�,��ߝp�5���d�j���-y��z�ˠ�o�a#��� me�� � oq�q��i�����;���3:�`��t�r'c��n��x�^y2��ig�)w���6��׭1��ǰ�~�#�x��'ˬ[5��q�\t�w!s�l�y'g*��^x�8,�pk mt�s���a& &com/storware/ha/rpc/swhaconstant.classuvkw5��m�g�6� � ��gyz���^kەd��8�is��i\�����g��׫ ��9��;3w��ў��ϟbn��&9l�g�ܣ�e�k�"]� h�ҋf���h:�lp� ȇm��m��n@6z�n��yq]�|@�\@'<��p@����0�d`����$ ��\u *&�eϲ5rqͥ(ҁ\�9�erq�`3��a!h�)v�^@��u���|@nإx��t��r�\h�����l�uȩ.4�1iʮن�"jx�]=.������rg��r5�g]���li�9�rf�{t�<�n�6���p\i&"h�.��e ~�.r#{�|<��rw��5�̴\,m�s�gaҵfz��d1�k�=�h�pkٔ�����i/�e{xftюҩk����q��"6le�!k���u�x�6]b'��uנ��{���\啨�uǖ��!�-g��u�ǖ1=�yw�ly �{!�]gv�����t��4"v ��6��ox>t;���c��v�ע��e��ֿ�\)�γ��k-��}s��:�`k�ބ<�ّ˨�'��f,��fl1 r��ȉ����>9�����h�d�����!����q>95�_���y ��{�r���{�v�쳼(k�,u��<�`�m;;y::����'���~���l���my�x2�� �s����:i��v�[�\���*�5��@���[�/y�2� ���o����x��� ��h驪w���_��ˀwq� �wq�kh�ב?o �7��[(�m���齇��g� | ���"?>��ǀ?��m��z�3��{� �_z� �_�����a�~���������h?d�ҏ�>c������9��ż(�"�c�����f(�>�����g� ��#���gzc��t�=������b~h�g�7b���(����?������pk mt�s��(�u!com/storware/ha/util/hautil.class�ums�v=�vl�i�i��0`# p�gӂ!�c�@۝pހr[�hr���v�u�o:�i�.��l�f�e&m{����`/ޕ��}��s����ퟯl�$�`%1��$�p#e�l�c6���so��8�e�� �¬�/������e����:�--=�)���r���r�qۖ~�ޮ�s��u���;�}ϩ��n p�x�jvz�3֮ۗm5b�j��,0� �k�qn=�]�⹁w�vñ\ֶʾ��|x�v ��j�����w������wʫ���� ���'�s۪��}e�c�s7�m �@g�s?x��� -i���������' ��iu�bik�2٩��nr�|�f�#} � �x5p��dvd�_znln�ҥ}u ����� �%��w�mg5<����d7z �mp�xm�c��m�a��m��ml�d� *rᄮ�x��؊�]= [i ��#��vc_��.�2s���������=�l;-;���#)0�f�8gg����]k��ޑ�慒�) �'��}�-��6��g�d�c�'�#���]�� ��8||��~� u�\pڳ�t����֪z����$顳��= ?���_�9ns�b{է4%���uw���jv�v�c9��ѣ�o��a���� ���z�o������ :p�k|�j���ѷ8�ű��2!�53@x�����t&�q��'�g�7��~�z:�mu��p7�#�楥줺�h��<)�yq��|cf�x�� � 1 � �9���z����#����e��c�8��.�:�� wpg�)����1��]����6p����:��4�-'��� �vk����;�fd~��ir�j�~��i�k����]:�b����ȶt�bg��_ad��ؙ�dp��nuj�x�� r*�����m�?�}�s�����[���b�t����k���f$m���pk mt�so`=��&7com/storware/ipsan/console/control/calendartext$1.class�u{w�d� �ݰ�t^]|�v���t!`t�]�m�-zp��bh�%5�`f��q���~��s�����<�,-�@�srs�;���ɟ����<�ô�>l�1��-\če�f�&oi�w0��kz�]m�-���m\6q�d�!�696�0]��#u�l�d8����ő�c��*�c��c�wi&����e8����m�o��0���p��v�v≥@wh��<'�c*�b䅱$�u�6c�ē���fc�6��ڸ�l�l�q��2>$|ᦍmv񱉆�o�>�q ���_�����x��9v�j��~[xԋ�o�m-�jp����[u�ѧ���9f�t`/���d�����o rs�[[tf%�aɔ4��3ѕ9�؍�g�ԓ�l���r��� d5n��9]��'�b�m��zؖ7h�jn�&��p�2/��r���%�=����΍�h��n�d 7z�kw돆 ����_h�m���:r�{��tem�%u��3]_m,����z���^�k�4k`�������c�n��h�<�zc�_� l�>z�6�dsd|��w��^rn�����8��b�0�kk��{`�����w�����j�d���c���h�{��f #�z�ؗr��a�u`i�,f������/(j�=�ze�e��:�l�$ d%qea�)� s���s���#�����ӄnvc}�p#8m��r8c��!}�f��e�����ƈ�fg����#��y�a�_2q�g�0q61n�o�����n���i=�*}�pk mt�sl���9com/storware/ipsan/console/control/calendartext$2$1.class�v�rg���� ,04&��e!h�e�t�hl�6��22;c��b�)o��|�p��#�g����]$�\ت�>}����w�t������|�d #���d7n��0jb ���øi&z�u��ot��p��$��d|����|o����l�� �#�ig��c��9aيtn�pz�z$|� �(��ux�#<�eh� v]�u��&�Ԫ�� �2�ߗ��(�����x����ip��]5�p����|��z�(�r�//w� 2,��4gr�.���㺲e�g�hkz�ض�����k��p�(��� �~��s�0}�� ���rwņ�*���yblꎼ�ڢx�a`����б�nl�n���;�t�w� r�ңt�a�c8z�!g>���8.⒁�".s\�u�8�#�q��kx�� ?��� ~5��m�� z�'k�t<�*�hsivv8���e n�ge]y�k���s#%�0�5 ��s�n�b�-���ǧzwq6�{7r�ed�l��[.��n�f��i�mc_fhg�l�d���2�[p��|��y�~�\5z���jѕjx8��h�qz�b�7��>̍h�do�]�:� } �߳y����:�� , �t ւ)���nyݓ:�|l@���rf�ԅ�^h��՞w!�w 6���c�7��]��,�hڞ��x�\������z��"�:���zv�* m���q��z������ُh�i�l}wv�9xv�9��/��,6��� �?q�ھع ��1k:$�?�|j�t@{���*z�[`[h{ c��d}����$}{|x ����ls]�ds b�`���}�^��8�g8��1��%���)>#@ �h�s��i`�����31�!d�o���8j���/u��pk mt�s?�����7com/storware/ipsan/console/control/calendartext$2.class�vmsu~n��v)�te�� )�rp(֤�jz�������%�e��ٻi�'8�wa�?�l;2�_�o:���j)6�l�};��9��s��߿��"����l ₁q�f.i�,��ⲁ�mt�=��wm\ä��xפ��(��u���6p���f�� q��j ��פe �a�qq��h8��x�a�b_�6�b�)r_���7�2�*o0\�;�^`�co0(�@�5��"���>� �c�� <�zܞ�i� �n5t����i�*��� �!o�è��'ᨵ��"�����0���(����q��g%3ā��^غm�neq� ��~x%��뀬�u��<�:�8��^�_��{w�7��y1��k��%q�7�m����bz�x�����0�~�{vĵ�3p�b�^� g1�p텼1p�‡���ǩh�y �h��s:4��,,�s k�m�3 �� ���/񕅯�-,�5�y�c����:�o�п��[� u���dy�x�}��u�@�c�c7<�$��<�i�s � �d,�ӛ��<��ri����: ��("n�û·-����$y�**5��y?��d��n�n��o�d���_�q�q�p6�ow��pk mt�s�.d\� �5com/storware/ipsan/console/control/calendartext.class�w x\u�ofy3��v��d� m&m�{���m�e�vi �,�ef2y�d&�l� � ".(.��rj�"ti�l"w� w\p� qe����2iӥ,�/�{��������w� `���f|,�&\g��\�7��'|r��b��o���a>n�@7᠀��l7�`�����v������y_���c8���(�w� �e�!��@��k�0(�n��w���'l��jq\$���|���= ��֢�}c0.3����l�m�ʄf����`��n �f� �|o��c��~h�g2�x��d�o�l��~n� fs&��5��|>�wvfs�v���)�6�v[�bro!�jw����br�&x�hp��� ӛ��t,o�=�d,���c'r�b>&��-��(��j]o��͐��� �ž;k���l��q���� �n�wrc��'�� ɕ�m ��l"�0���$��vw$s۬�4w*����f�l����b��,l�g�c�b6���%ctaeb�l&�m'e,��f���{h�a$n}�)\�x�պz�ٴ�i�z 9;�"�7�w ��3�c�uu���owuڹ|�)�h�upm�d���\2^�k�˦av�9i� �π��ak/ ���:�kj�0����b��o��z��s[����d6!�k(v�y�f�tx�dk6aw�k��df�_��4o�f��c�r�t�k|s^!��v����#-70�몦rvo���8��p��k�n�:ϯ�m�d����� 4%l<��%� 4 e�z]ѕ�ٗ�جtk���;� �� �n ��3۲�`!onv�ә��2w�cgz����ܜt����vb�l��8w��p|��^(���f[b?�ľ^��c��i2ͳ�5p �p$_d�d���d�b�lf�����g����'%���]vnm�i�f�a��c��kհ��픭���n`l��e��e{3l����lg�x�d#ڣx��0��&~�x��bli�#[ �2�v's�����2r�q��gyt��jo?|}�gu *:�� e��jqm�� @8�bjp���["�i�ɿ94j.)�'�g ވv@c�qmp�c����(t��0�(on8r��;�q��#�\y�.ƛ���y��v��6 ��>���"&����� ��"& ���p��1͝��ywq!���[����z��,%so��_�ib%���\��"����=�9l�m�"��3�@��� #�o�� �"b��ʹ���ԇ�؅3؜wj�6;f���u� v ng�r/a�cy-h�r�t�q�����e�*�_��0`ة��bҥ�{j�w�h'�5t`��l�k���p�i�1��� #��pi�_oo�m�����y���4e�/�m�ax����%�l 1��d�rװ %�j�ǚ�e�yjf�� y��2�\!gf�;�?p�ϗ��x�>��n'�)שbɩ��=�%�"�]�>¤�i�cu@�2k�\��� �cz� f��<���e����"�t��&�ts��彪d�� �����>̝[�-�� b~���x?��{c]����"9 ��y������h��g��hj�p��u��/��l��}e�d ��"v g�b^�&/�v���l^���(/o�y��)r&#���;y6wɓ���r�{y����z\��n�u8�g�}8��� z�t�w���>�&vfͷa�x(��p s��x 1o�ҡj��i-g�yeo�z-bu8�_p�y�݄yc?���q#������$��x���jz�!��2t�fa��e�*q ����e��azs���h?�ro2�/�'ei�tq��rzju���qrh���'�q��o��=7��snp4=5�"���#ʤ���h�麦8� x'�n&"���_���ѳ��;n5����f��v� `����qb�k �ܮ6t>��0��(��1�q֟'x�o2m�b<�v� ��,��r-o$�;t�n*am%��f\�s�wם�.]���c��g�^@���_�n�/� icm�q��zs�|���ys"����� �� �ޛ$qf�h%�ʏz�d�2��3�%�\�k��b���3�̏�o�fst��fu�=kwe=�ۮ�f�;jm8z[꼾i�j�xoej����*t�vu���b�:�u5v�6��or3f��&7wü�څ���va괃pd;�� 6��n�]:<�bw�l��ǖ���ݭtr�n����tq��q!�c@���t��#*|e��t��\e�]��g��;�u��u�|�-�9�2�_>bn�$7�����s\]�[���v^\z\�7�8��m���ϧ�5 �z��֍ȑ꒚j|@��s���e�>�� cn��i��7�gt>���^�&�ρ����pk mt�sr� \ 3com/storware/ipsan/console/control/sspinner$1.class�vmsu~.�,��z�r[�" ���zke)mm�6j ȳ�&k7�qw�������g�������!����l�m4����{�s�{�����ͽx_7� oepwqogh\�`�y{��q�x7��0� ����&0�`*�f\m�m~&y�b�{��;��6�i�!��x�q�q0��@��3����`�p��;��j�,x����9���:���lۖ�-�nڦ?*��մ�ov <�h���i�����tg�e�,m)�эy�5y\1��������y��z-y{�q�c�(zs:%]荥7�iâ�r��}m�i���iv�`= ���� м�u�qz/t�7 s�� (fnwg��7n�׺��隥�y-㻦�q@�"��r���;\dg�l�6,�#��sί�9�0��,ω�f�>�� u|�%:t,�f��h��d*r0u�bi�#��q�(�֊t�†â��sdu��t�(�xú� w�'�_q[մk�j���uiu=�q�2=_� /z��@ ɉxõ�/�h �b�� ^��խ"��k�z`�\�j�q=�0�g�)���\$��#e𤟦��/�v�ci��u���f١ѵ efn���?��w���&�����n]r0��|�pw�� !�h���tl��꒤��,w�p�]o�p�=v8&sr� ҧ�:x��!s�y�"������۩�h�p�%��� *cl|�����in��^%x�qi���pbx`���hr�j�dup�5g�ūt����.���i�z��q�������u[4���$��t �'�q�bz�@�h���*�~��z�� !~l#\�k� �%(ecc �%d�g��moѵ�vv݆j3[a ���sh�m'1�[�d �ރyq�"��ox�����d��;��0� ��f5e:�p������8��rbt����j8����s����>m�}��x����:�噧�^yc�'y�s���c���6^�g��}\� �wє �0c��]\��r�����%t��t|�.�o��o�� ��� n�v�b���dmv�j�wа *���^�����p_��u�k�g�2�#�a�|�pk mt�s��>h3com/storware/ipsan/console/control/sspinner$2.class�s�n�@=���qnm�^�k� ��t �"u�ԇ�m�%�ա#�m�_�_d����q�y'��"˳3�3�{����&^fa`��4��xɗ��(i�d�o <3p6pa��;**��n��q��"�\�#�s'���z�����f_�� _q�k�x��^���r���w2�6�/?�z2�,ze��#�*��-������'�hr�'a-m�b�h�} %�� �r#�\:uj��\�h?��{y���d)#��k r�x8g{�?����cl�4�fv��>4�:@�i�=��_9�b3�o��;"�4>` c!�����i\�5�jwl7��.i2���q}:���y =!�}�ӥ}��*jf �_pk mt�s`j�:8 e1com/storware/ipsan/console/control/sspinner.class�x |����fgw2� �`��d�� �"a,�� �$�v�6��3�����go� **�*j�d�"�j��j���/{߭w���f��c�$�������w�����x��%b����d��� �b���sp�>��y��1�ȱ�a/�ݤ�f����>����� ��`�<��;�b8�l_pp��jު�0�a��k�*8�b�1��p?�>�=z���8̃/)xpe�qы�����hd�8��ý 3cxd�qk��'�xtŗ���x_u�5<��i<���4o �����7��÷�a�g�c���; ϫx�u��,#ے�s9#'p�ѳ��w����v;������n'��l$ 'm��;g:f�@ȴ2=n����>"�q0��6�c`ֈ����"��.�� ���.f�������@��κ�ٖ��bv�t���:f�8xnz��b��� ��_�f����ƕ��a{m5���͌k�i�f=k�؛�;�&9��5n��9���$ofi݊�m g� n����� �p�ycw���dd�t�de�if�d�`���v�=��[e���� ��k�w�j"!r_<��9�2��3�f����you�"ǫ�k��*�=~i���\���`��%[b��;�c.r�{��,rt�*�j�&�����r�= r�c� ��ƛ�;�5�n��6��ٴnn�xӻ]ߡ��v2��dm �\kr��"b�0 ri�ǎ\nncc�@cͨb�֕�j, ij0xըh�itc�ȧ�r�\̃q�$'��vo6n�19x��k �ld4l…:�� ��ؠ�ޅ�6��e 3lc�2�-��6��}s����� �����~��c��0���g ?g�~)0�-�_ï�������7;�4����;h � f���m��{ �gɹhß��q2-������c�v ��5���lٿ����r�%����ӹ�v{��4e��4��b�� n �hx��i]���[�s�*x]��������pd�&|¯�g�k"��>mh���1s ��-h�dib��d��ة�1p41v�q��qb<����k`�)�\v�51y�u����'e��迋 3���m�v�m��n���fg��vَc��v�7�����z�z��̄�m"�|t�n�����v5��9ך|�t�w�kc��fi�t��ut�'�v�e'��ڷ�64�5�j�mg�g m� yq��9ǐ��n���.�\t�dc����%��1 ��u��f'�m�##r�t=&l����~��~��6���s��襐�o�p��kk��x��2�4o7r9ӷ��7���0b�i���jfg a�[�%�[��k]ĥnު�\�r�$���c�6�i��hf�<� ��2��{�]b��%r��:s�l��me����ѷ\r��qy�êy��^1���r�v�1��g�?!#r n��;ro�` ]:v�7&ԕ�o��q�7��ڰ�|���zv���z�/��њwd�̜ln&k���o�����p�/� ~<ȗ�ԗ� c��^�嵛��"��x�c�s �m��l� �"}(��^�`�� ��!ġ2td�n*�n�չ~^�x��l��vx��a�\�1��8c�co<�a2���l̤��y��<4a>τq3j��8�>��pg��c iy�j�8��������{�'{����e�� zk�^��tz �p�9�@u}��r ��r�����q �&0ld��p�d�)u�y�~ ՝}���!<��h�ڋ��v�bf]c3#�0��n��l��(y�y���by��.˩r�}���|wba'�&�zw�a]�� ���κp�m�#n�籨���;�/� _gpkgʖ�>�?��q�˴��8;�e��d)�)�m�e����%��~���y�o9}���2j�f��q��exa�<&���*\n��b5n�y��v���s�/�*z�^m�ə�\#�!\'��zq��29��a��c���n�s�����]g2.a���r܏4,j�2~�{�p�$p ��f����[�\7��(���9�>^9���7�;�s��m��0����,dq7�unxz( v�;/�5���y��#vu��4��@z���n�@%�a�#�o%w�fn��΋�d�\�;q#b�ι�v��������a�ïa�>u�g\j;1o�gp��icu�.�wpo�,�c��}��t� �p7@�cx �sp����ra��ve� ���j��k� ��hj6�9��b��r�<�ċbb!������(� yld��9l�^�l�뽺�vqq��io�aڄ�d d�t���n�7^ey8hj\q"g�csf򠜹��"�j2�n��j:�\�f�x�huw��|�<����.{װu$�ڒz� f���z�yy1�}��d�@a����~l��v6u�r� ^��n�pk mt�s����8com/storware/ipsan/console/control/timefieldtext$1.class�u�su�n��v�4�v�*��c�pp)viik0�ش�-��n.ɖ�nf����/��� ����_�q�g >v�53����*ۧ:>í$�y^�oj(�b1��\tpkcy�m �3 ȧd ŋ��@z���i���#�s��c��-�` ��"��z}�vm9�p%w���5�ļw '*� �tz[�_�[y2����m�gƅ"�`�]w��a���sg����c����2���*��0���za;��� sa���2f����e8^��zt��}*lx�iq���m���wfm��ۘ�pa�k^ƿ�m؇��vp�j��x�� �����`���8eഒ�� � j v��a��=��p����4�pz_��� x���  4@|g_�;ױ����m��i:�v0�������e=ʾ��;��u��/�b(�5����!c<�vz�%�b���k���f?ʔ����w.h�v_g����ԣz�v#b�p�_\�f d�ƹ�iф��a��ɵ�l�<�����gt��y�{��4��r��r�-� w�zn��p�ٞ�0�_rv�h���m��t����1�e��}��i�nc6ô�`���¥���2�c�h|�rz=&���[`鴚f�o���4ΐ��f�/�o� 6� �]�b# `�#=/��j*�*�"��-�՜� ,���=%��������]h���"ٓs]�] ~�����nez�i���nx�bz)›�%d�@�-���(��t{u��yz���a%m�o� ������ru�h9t�j��� !�tdɼ�ʼn]���}���� �6�!�y��az5��i�u@y �2�b��}:�u��n46���!չ^����� �!�i*d�n!�'�5�υ��p�.�=��^���n1�;�� pk mt�s��9o�x9com/storware/ipsan/console/control/timefieldtext$10.class�u�su�n�v˲-��v�j�$��4m ��$�$�� l6�d��nܽm}��w_���) ���79���6ml3`;$�������|���_����4��a�:ɛ�abj�\^� ��8��>֡!7� �zq�opv�k:>�e�]qfn���� sm�ϋ�\ca���e� '��\���f(�`� ��b�3m� }w�� |׬8mq�n�"�����yb>���� �ĝ_�e�7v�ut��˙�o[�8*�h&t���y"�s�0�w���,?����b�� l)j�l��us�.s3\��x� ���޼��ʉ�9�?�>��q[k֪e��w7�2p�:/��e/��vԦ�"a$���xd��%�e%���h��4uf1�����!3��l�5 %7p��;x��a��—n(��ᎁ,�s |� al{�wv�&n9k�.�)������う�,t ب*� �u�p���%p�s{�*br����%���z��e'��se'�7d�� v��%�e��ޔݲm�sy���^�;�'�vn����8��6��ێj n5]� ������ �n��� �.�x���x�n�v�v޺1#�p(օ��uvi�����ɴ"��f�8ў�j���b��h7y:f"��f�pba�^�er5�f:�����:w�u�9�� e ��aɤ:�m�˿�8���؛e=s�(�=o9���l�z����(f��<���a"��q�o2��^�w�� �zg�/����޷�s�:��b���bo����iq`�7t�dry�r���8��c��ޡnȑŧ��� r�u ��q�!culs���sq�ʌcm�@>~�~��� ��.�qǜ�<�q|�z �g�@�isv?#�!�n�œmɐ���ow}�cu�d� �^���q�� ~�g�a� ��d�pk mt�s(��n� 8com/storware/ipsan/console/control/timefieldtext$2.class�v�su�]��d���|j?hӛ��tz�m�� d[�e��m�ݸ��3>hg�l_�� ��д����}v���q:�� _ ��arr����s���~~��o��т� �5�.� qy,�ȸ�a#�*ěb\�z � 1&ᆌ�淄��i!n�gj8&$ܒ0)a����n���/�ۋ���β�p�(������&ߞc�ꌱ�o�����2e_1,�a�<=>�l�y�p$ex�vq1ý-c��h��5svs ����x%iy�i���rz�:�g�� ����i�,c4�����u�ҹ�.{*_��������rk]nnلy�*<�h�����mx�7��]tx�!p9"9ayd��t���>�i�„v��/��ct�47��w-� b�s��uċ�ڒf��t�v 7�����0� �mhwp3�u0��$���6�(�@�qw�g�'an���]��h�o�(�!� �c�@sm�ʩi�!��e��rg��y 0�xt`��pp�1|�m�;��"�x��y�ss��w?s��qb ������s�jh��5�_#i�� ��z�l�z^s4�e�c�����pg��a��x"~��o���d�\y��p2�ț����=t����m�"䲑�q��r�;���hho�g��� ��a�o g�(� c�.���"ie��&����v��<��pn�%�l�s/p�(�e�}��sl�s�@�ߋ>�ҿ0���9iw׏ŀpk mt�s���n�b8com/storware/ipsan/console/control/timefieldtext$3.class�umoa~�v���eea-�z���ed�v[m,b�㺖��]sw���[���e����g��b0h�m�;3;;�<3;{�~� �bc@��a��"!#�!��ᢌh2r�$�q i  y�v��b)�т�t5�w�5��y�t[3�s,.f�u,mެ�9�[�y�̟�ݓ�m�s y������s� ����v��ܝ�-�tc�t���1,�2(y��{'5��ѱ4a��n�|�.t��zp܊� ��s�[�5��m�ӊ�wn(bf8b��l�k�dz��k�nw���v���|�xz�k/ c��䬸a ��b;""p�r�a9e(r�)k��� �*8�vq!�cb¤�k��� �ㆂi�t0�y 9s�%ᶂ<�(�����1d��/.s�r8�on ��s�ڮ���0���@�2\��|�f��**#��=/�i�u~p� ���kf�‰��u��o�a"�.u��?�]2�\���7gs� c@�o�q҂���ʻt3e�����pwz�/q����ԫj^����������t��2t�{�svp:��g?�� ����q�$�\��?��v�4e���ɡ�`�/h�|���j>�st�x��n�id�gnn��h>!�s�o`[m"\�ġ���z՗$z�lyx m;��i�(�8��/��k:�n�5�q�e�0������!�p�|�g/���d���@\by�t�� @�� 1�)��=��pk mt�sɖ���8com/storware/ipsan/console/control/timefieldtext$4.class�u�su��$��!i(��*���b(u)ii1���b�zy$w.w�����2*� �t!d��g�i�q���e�2&�������쾷/����&`'1�c*fpp��r��br���@��yr�n���;��c�i`f³>���b�����(()�t�g qѱ�l��p6ݦ� �[5<�[-�pt�u|���)<���&���]��w��>e9��f8�����cl֭q�e�����e���6!�k���y���$ˠ��{�����̉-��l����������p0[v���m��s�_:����sҭ(��1#�_��a{u歊� �'��e��)k\1n�m8u�*<˩o)(3�u���6��3ď�Ԯ�cڮo *\4ܚ�����-�ְgj�krt���e qe�u)����k�����%��`���e &�'�|^�m u4f��;ӷ���򳰢�n�i��v0���/,�p�z�yy�˖/�#����ő�*j��qc�3$�y�ӫa�ܧ��&_�/��q��(�f�i�x����� цc�j��ztmyrd���� ���7�t&c�rp�č;=l���y��^#{_��a!�� es���,��l������kd��m:e��0 ������d��|n&î�昹e��ӿѓ���s� --��whp�����o�a�.�0� �j�i���(��`/�o�6�}u��#��lj���>�q��b��pϋ"� ��f���ȅ��c5��e��.j%�el1d�j�hj���:h��dj�`�������;u��ެ�h��$�-����t�=�~@?b���z@��oou�ب�����^pq�/\& �q�}�!{v짯x�b$�f;�km���|�����n��`�^ u�kzmp�����/d�!ُ�^�h���xp�%ޠz ��$r�b$�$"ct�� �v���3f�y�����ͽpk mt�sh1��� 8com/storware/ipsan/console/control/timefieldtext$5.class�vyow�.�� � [ d!qr� $@[��!�� sڤ��fܙq?�?��k�v��8�u7��u�*uq u�"ujվ�������s"*k��=���=�߹�����р���cx8�g� d�x� �4�c�y!�烈cp�! b؍a~lh� ��b�h lj�kf%�1t�ӻ�`8�Ԭ9�q-{^�����t4�t,��o׶ eb��tnd&�5������0tgw��d�ǭ gؓ�m~)?�����6ȳ7ii�1�ںx��~q,��0mn� �q8-�v ��c�|a��g�!mzvv�a�\q�]�_��(�|ahh^��7�,�<\���ܴ�9ʘ��^o�t3�r�,��ˉ,�7]2����� �)w�fgԝ� o0좲ǹ�u��p������٦c��q����!s3,g7�#ܝ�2�e�0!� �2�cb“2&񔄧e\���,���<^�0�z�&df�r�h���"*cq�f����ur�mh��� 32fa1'ä%!'�%x>�����1���f�3\����~&u������ύ�c���4��.?g�&d9t��2�i�v5w�� ����{$�գ:�������$r��b!d�x���r5�����<��c!��l�sե�޲��fbz��\�!��[�� " 9rdym�v^ߧ�i�=4�hy e��]�g�zc�e��h"k�k@q�\��tmnd���%ʊ�r��qw�v��p��fݖ0]���ʩ�����[փ�a��o�>�px�oz ��ُ� m�bm����n�b�v8h��b��p�dc1�v<x�؍�����8�� �/÷�u���u�}�p�t��b���e�ht ����?p�5kh����7qcʹ�7�x��g�rmjϛ�}�6������� d p#� �[@� ��q��r�oʜ*�;u�,���@mk��5to�n��g7�p��-���a�x}�_k���0�4d���]j�{������8>d'>b?>����������?��ϱ�/�5��� ����o�'�c��=�ŏl?�~f�7�a/���q����;yb���ϫ�f�_�z����a"� z4#�|݌�0)��7j b���hge�0���f��r�� �ck�c%:��n��o?���b��i��^$�pk mt�s{�w��b8com/storware/ipsan/console/control/timefieldtext$6.class�umoa~�v���eea-��*/eq���v��������z�� ?��e�������_�q�j,��ؤ�3����3����盷fph����ч�"�*h�h�_�r��b��4.kuh���� m��%bi����vt�ޚ�qݪ ��m�����{���[>gq�4ϟ��{�r,�a4����cx�-q�����{ �e���6y��i� �gi}��`���po�6�ऎ4|t,c�պ[���k�!�ȼ^y�m۹.�|��r�z!��j%@�g�_�ɵ"y,��nny/���i�h�7̧��r�!4ew�3 b@~�a�r�ul����%��`l�\�p -�rdž�i �0eq5\� ӹ�a� ��pk�m 9��py*|��c��y�_\�&��wߜ�-�s�ڮ���0��@�2=n�|�f�pbvf5l� ˤ�:?8ȅ�s�5�t��a��w��π�\���?�]�d�r��ď���c � �%s�(ò���ʻx�d��pw ��mw�r��dn��������t opr:{�ә�t��%�z5p��e��i��1�p�ч/�� �� ��@��b�ɗѿqt�,�;g���t�wo@�<���#�����~pk mt�s��8com/storware/ipsan/console/control/timefieldtext$7.class�u[s�t��q,[q����6% Ԥvz���hr��6�i�((�t�<�ܔ�� /��p30�s� �a��ĥ�����ݳ�o���^�����`�0��*�qt��$s�\�䒊˸"ɇr��b�t|���x�'��ģt/i� %�(&�,כ�|����3�a��b�b�m�\o���n�|��m��][�5�\[_��b�vmm< �����x��b����ub|ɭ �p�rĭvssxkʀ͚l�5 {��,)gʸk�ʎ#�%��}��ܡsg/3��g���o��f��u\�� �f��ہ.�'��eiv�|�����`k���x�he�saŠ�ŗ%no �6��^ <˩� �Ԫ��lf����inw�1m�g�4ܚ� �p[�1�0!�u|��$ui�pw���{���$�r�w��cn��|���}�lpob���g�h�_��ض�������1�m:�qҽ�7���=ʾ����#��_�e(7����l }9yҫa����( ���o�7zq��({b�e�b����� ёk�m��[tmyrd�n�� ��e��c�l7y�r�t�3�vu{8�h�w�w��k�ě� �]n$�?84l`��f �.<9�����[d�a��rvq�u'[��  ���1�e���}��)a �4´�0z-����}��u4>�?�]���?�qp:-��� }��� ־��b����_@���a)�i� ��0��x׊#����ƴ���f��g��?��v�w/b�!�e��"�ׁ����]>ձ�����i?�x$��v1�;;a5� r�4��#c l��j�h),��ud��^���_i�?�txq�����ۯ�'�!{v�_9�lg��; ��.���#�o~� �̑fxk��qi�y c�`��0�l�(��(n�1ܠ��t7�>�ruw��,"a��s ng��lxzgq��8� x/<-����pk mt�s��m� 8com/storware/ipsan/console/control/timefieldtext$8.class�vmsw~ix�.��&�"5a�ja���pbi�ol6�ae�mw��пp�b���33�v�?������~�n����m��p:�=9��{�s�9����w?��2�8�0���q���bt�1�����ul��iqm��q�1)� 7ui4ߒ��rd��rqy鸣ஂi3��`�����y�]����v o�v�7�tߵ��<���eq�van< �8���x�a(����b��t��0������y�s�pb��� 7���k,��ii����7 �0�� �[joy˟���&ө��}���ӕd�zp��أ��ln� �4���y�!�u( κ:�]{��%��,� ��u�b0��#ǔ5�1����g���vw0y�c�\�#~ָ4[nkf2���#h�jb�`��]q���){wc�vl���ȇ�l'e�ˆ���"#oߺ[>���v�����|�[!��1t��8k��������d�:��p�e=�g7�m�]|�) ��i\8�f�rv�i�8t��9"�>fse�=f�/���u�7����>m@)�abs�g[���hڴ���{k4�o6mfc��т��ty��ġꦊ�zc�2��8,��8rf�zɵ�r5�j��p9w�y �z�殦��и=��� �� _f�.�gv��݂�3����6l6#�mu��n��z�i $� ��y\�s���˯��~�i�xf� �w�o4�?h�� ��4ɿ�st l��0���'s;�2�9$���)�"�ԉ^֢�կ �z�3�y� ������ ��fs]�'��h�_c!�8�m�mm�mr�� ��/�"g�o�e��� w�_pk mt�s],�b8com/storware/ipsan/console/control/timefieldtext$9.class�umoa~�v��eaa-��*ora�h���$~;�k9��5��o�g��d����o2�� � zb������>������_�c�-�w�a@�]�u$�t� t��po�0tiܗꈂqc ���mk�� #yӭ��w�]��u����#\����\[_�*|��vi����h���x� �x����5��[� �y��ە �6y��i�k�gi���`���po�6�ऎ5|t,c�պ[���i�!�ȼ^y�m۹.v}��p�z!��j%@�g�_��uh[ǝ�ۆs֋�g9ez�t� �]���l����1 ���@9�:�� �p���[r�@�$2.�uctj1�`z�#�pt ��d�,�j�ü���/k�h��'��3q:o�9e$�s=.9�ѻ��� ,�mb���g�f�v�fh�55�,��� 46�x$_�y�׀@�ѩ�х�g�>�o��l��!b�p���%t���ڒbk�})����6�r��w!�hakhg���^c�-#�v1��0���}��c��� z � =�i�n�5�q���p�m'a�*ĉ��&��_pk mt�sc���!6com/storware/ipsan/console/control/timefieldtext.class�z |tg���;�;3�$��!!�%�&�w��h�m@ �r�03ln��ę ж��z] v�ҥ������x��xu�nu��ծv���c�����vk���ݛd�̴�����}�=�|�s��{.?����`��"�� ���o �g!�"�_�|kȷ�<-��|�wd�]!��w���������u�������ɏ��x�o�<'�b~&��b~!j���>ԋ�z�jv���_hp�0��k!���� �և�n&���}h�&�������t��a ��"vz�<��/�38u�ɇv�n�k>���m�_�a��w}�$�5:���c���ýxa��2%!�nza'�1r��gn!����|4e���e&t�s�ne>��;l�/�\� dz���yh��>���,��* ۯu��s5��j$���x(��� s�b�h"�;�� 󻓩x0��c�h0}0� oja:� ϥ���ӌ�#vp�֙q��s�p&��)�q�p��!f��)t������lp ?�vc���h(*t9 ,��p��~��x*44`�%.�;c�����bbl, �frf"���_��wl|���7s�lw"=ĺ��::v��s�y�n�iuқ ���r1v _�(b�(��7�hkb������. ���r��c9��s�yc9r�q��f�=�je� fg25�#�/����� �����k���m6'ć���3m-qf�%�:հd(��� ��9�w�_z2��~ڡf!k��-{������f��j;5\�=�d�l��/��}ufwx>ـu�i�[a��'�3�� 12:y�땹ov�nv犭�}���3h ���orbe�ҧa3�]t�aw���jq�a�x�s�w�m:m7�-�v��)b�zp�����w-7�oܠ^lk�zw}�z �$s� � � ���e����y��r13�3ɍ��wg�3"úljf2in7�x�fl`��֨5��6#���j7u�a�-��z��vs�ē1���]ўy�r:%ld�p�trx:�y�_���ns��l���{�c�h����f:�&4lt4z��t�a�^��wf�w.p��r��r-g՞d�ܟ�(�}����a p@yq-ݎ[��ض��btԮ$a�33i �] ��՗�4��7�4��q7uc���ɔ{�~���&e�x�-����}�gp�z���^_x�||� ������d�ѯd� t��� �;44�8,*$:a�.>�}�i��(w<��ʌr�b����v�'����i(�|��v���~�!�%фs�&��� �'m�-����(��97e���!�so���6?�x-����b�.�=��� �l �yb�b�b4!��!��y��x�x���e�i�û�����b8q /f� s1�g՘��c���n���� �c ���5gxx�^�p��9.��*��y����?ц���/pf�#��ws��n���41��bf�2sh��yb���46e1�bdw�f����m_�~�]m���)]c����t�栽zr�b�����(ӝ�����o� ��=�no2�[��;��<����f]��ot�=�xo�.ǩfko]�؎�fgm�������2r5�v��bg�;p�<�����r��#p�v������t��b�d��nɶ*�5ъ���v�����b�s ȡk�ѝ��0��.��ݨ��b� t3z�����>����[1@fg�����x��{w�v�km���x%9����?׿;�fj\��n�upr$p?urzdp7�\�&w��qt����!�*��d����s�ʴ�os���j�]�hϡ��e }�c�4ӏ��<�u�3�����˱�d�:u�g`� ae�� ���o1^bw��ik;���c�,僨�u ���5���jjd��� hs0�����g̥sr`��3p��m$�t6x9��vkj��@>�z�]�-�u��*�c]�����r��v� ��u�e�=�9����{�`���n��ˇ���s]s���m�5z5�5�hs� m;p~~�ޡ\��c�s�pǎ�]�/�b :�m\�t) t ^����g%������mr͌�|�r�n�^��$�sj�i̔��)�kg���,�u8o �xdd�yt�l� �>�z5i����/u���n����0d�4,�*�b��6��z �i��k���6����9�|��m� �⎝�{��淗u�^8�cq����=x �m��������=��q���:>k��qف �)b�{���1�tcyn�&����ffk�2������s�<�b.�w�7p�r� x�" q_,���\�r�������.1���� ��]� _)�b���m]���.1���in�'*�^��ot.r��zp��5�@��m���|�?x:l���l�f�6o�y��m6o�؟pk mt�s�{oqq�ccom/storware/ipsan/console/control/calendar/repeatingbutton$1.class�v�ra=!�*�"�.�\u r ���k�۰����njw���o��u^(�|�a?�*��m��v�ukr��ݙ=s��{&�~~�`ki�у�8z5t�/�~\eq�����54b�� �����7y��y �l� �����7ݒ���-=exe_:��:�k ϵ s��)j�xre%�ٜ���dh�r�`b`* �gm �u�j�)o9j�r�pފܰ�ӝw��5�ylלqa@�9���}e�d��q��v|5�n;]��mʴ h�v`�-��q�is���cų@����⦢ٳ�_�� b�����g�i> �r-�d�m��җ݊g�;�[~���s�%)�s�i�>� *x����:�q��ishm`z� �:fy̱����qry��'и���t�0����< :q_�<ա�e x������ۿ�v�(�!�l�u������κ�2e=p��f]��&ms��r�t��{j���j"g5������q�[%�8ȁ3њ/��r0̡�!���#u�n�ezf���m����x^���=�qh�φ�bx)��s8��t���{ﰒ��"�� s�t:��˰��i,u�;:vq����t�t��,���ia �h�@��������boȋ�$��\�)�m�y8��@�1���| �3�c��޷;��{�x�5��$����$����g��h�@[���b�w���z�� g�ñ�hz�gb���@w1�0� �(&�3e�4�h2�4��]@{h}��:��a�/�^�^�zۋd���t-��>�ca���h�(,�qjo�ԁe� �ht�ɽ�.���"�3�5�/�꧑�c��pk mt�s0����ccom/storware/ipsan/console/control/calendar/repeatingbutton$2.class�r]ksa=ۤ��^ml��۪��� �ek5t(�k����!]{�v7�kp��(q�ztd���� gξ����>�w���j�y\k���uܨ�@-k��x:��h�`�t9�z앑�5���l!3u�ɕ��4&����`m���h�æ�v{&��վ�i`a� �mfg��q��ł��c�t�υ�؂@�c �~��'�͢b�w�ى���:��� %e��� �l�r�e��.xн�� $���e�r������:u<�m��sz�±�븕���)j�go5�4��fjv��/�ne'�s5�z3<%p��anu>$~�ogc�5po'n�ҏ6qyf�7���*���0��j���f[��t����?#�r���!��"��z�;��^į��- �#�=�w��v���l��,9�~g-d,@��}$ڕ��tɧ#p�t����y��b�'s�s��pk mt�sx�k��aacom/storware/ipsan/console/control/calendar/repeatingbutton.class�w�su��0tc�$�ԙ��0�%@�q'1$qc3ӓ�4v�$!>�#�m�}����_��ݪv���-k�#�������lq����w�=���o���w�o��1#�)������1��`��|<��em�f�#4� �r�����ca�wu�d`^��j#�w \�k���oh��u�0љ��ў� t���xo��=o[�� ��b��g\ �@`��ر��ى����p�����c��gdz�s"#�<���*�g,�h����w����g�mn� ˍ�]ka��_;j l�΅�w�:ah��td/z��t1t����[ ������es�\:=����ig>� ��y�-����t�r�b����0s��^�k% ���$�ܛ�z�l�ι����0}����a����� ��l�������e��}�87m�ִ˙���%�x�#ǥ�xx��o�7cx�y!ؿ��a� wo����� ���}��a��!�r��j�ڸ��nߞ�.�ut�r�jz�%��ja���ځ��o *&��u�n�6�;�x$3�r�� ��5#9&h_8�l��>n�r/�9��-�jϲ��������ur�x��sv!g����hs�/n�� 0�\��t��� <��t6i�ؕ�2�=�9�(�� r ���9�vs�[sػ���xq���؋��p��&�����1���}�qwj�u���m�!i�w� �x8m�~�-��u �3��ތ��i��m"��q��o񑉟i�s�$7zc��~)p���k��i��ri|r���h����o�k���&>�om����$��܎���3�{����j{jqz١ѭh;�v֫�^1�˕��f�z��n��� ��l���1�i �:.���va&���efh��,�qt�x�*=�tzr��窘t���da����";����r�ov�,[% b���}�֢)��5�'ukݻk�&eus��h*�)y~s��([kqe�>� �盤��el�bhqܳf|�y�~_�孠z^el[��[���n"���p�g�2���z�t��"d�k4li�h\��~�tj���o��mkh��b>h�� al�|��c;yt�i܃���ӽ�z�= ��! ���=b�1��h��q�cl��?`�,���j�z�41��wd����c����v ޳�{�6xg1r�k�1po��_w�45�w0f�p��̀���-���$2kw m����w.|�*qiįj��չ�j" ��z�h�"��-���&������ �'d�w �u��ޯ��log|�p���1�������ڼ�db�'�\į��z��f:w%�݋ؓ�n�t����s��z\��k�j��z� ���w��w���?�^g��`���ժ�m�a�o1��_�����z�����op{�i1�� k�v�8i:dwv��e�p��e ��m8��x�ln�0����:��wd�ɚ_ �jn����7��f w��"�ʞ���> ��|���5��^�qj��t>��@��w���(>y� "��l��tf�2� ���g�d|�j�c$"θ����#^�<:�zd�zϋ����1��|�k�cԏ)ȟ� �ߪbfٸr�@��������4ru�kp�4�w]��yř�m%_�����tѥ{8ӂ�)j�pk mt�st��t��?com/storware/ipsan/console/control/calendar/swtcalendar$1.class�r]ksa=ۤiz�mc���f)#� �hjqb�b�kj����!y�� ���w ~���8{�������μ=3;?~~��n��� �q �.n�q����0�~���~f����ʑ���̬�xg ���l������~�i����@`��2��s�j��$��׆�m���n�y�����s�t���j�.�c�w(��� ��s'[s�) ��,p.�i��j� f"��aҍl�r���ƹ�/xգ�� $;u�ձ��%o?���1���^��1���븗���)j�g���z�u w�r���m�&����_�7���b�^��x�-��v��nnʹ��c��ś��k,���9{k|�ϐ��c&�<� �����%��c��h�^_���m��"�����z�w�����?li�ϸ"��������puw˚k� �� l����%�pk mt�sh ��d�?com/storware/ipsan/console/control/calendar/swtcalendar$2.class�tmoa~� ���b}���*zj�g�z mckb~���߶w8=n���?�a������2�x��a �nvf2��33�����6�4�i,z� g�&���m� w��p��xn����m_�k ���8j˨�#��]�cǖ���0��d�<��#��j�:� �凾�f�*����ϐ�jo0���p�<��h�䙯kj��o�3i�3ص0q5�j 2 �2ȗ��پ﵄n�@�zx �b]f-g�! g��#z"����2�5v̟���g�ij�m���)#w����=�l� �q�n�r�a�!t[zi�ذq�a��vm<�ckpl���f��#l����lғǟ 5����{��ei9f��� qnuv�լ��u�`��]w(����d����l�z`�5s�����t�<��,� ���ȣa���ge�t�izy�u;��̈́�� x�@����2��c٬���m�gc�i�&�x���g��l}�c�h�(�ȓ�2��\b͠�3�%\byc�\��w$>`a�%ǹc���6q�y:�>aa�oʝʑg� \���"�k1��ag�~շ03����pk mt�sks�o�?com/storware/ipsan/console/control/calendar/swtcalendar$3.class�tmoa~jϟt|����*eє���i����/�ݦ=��6�k��h�� e��?�8{�@b �^r�3��g���ٟ������d�fyw0k�5#�۸�97q�¼�cz�5wbxx�d�uz�= 7�(���� �yu,c�㡈|��g[ձ^!�� �:�zah��m�tu��a�d��n{g�[|'��麤c�<�=�l� n-�d\ �r��ʰ �ʔ�d/�b7d(<-|�b�.� �����z�]i��}m;�ψ���3l44�^o�� �!wco< ��=�l��r*�f�rqss��-,8ppt`����kp�p�²�2v,�sp���kc���#�w��v��b1��v�!ʭ�v��עr3�/is���o�4��{q��l��#`��c��ڒr 3jx� �����w!�� ���b��? �ߤ��_���,%�saz�*p1k/u�-�͚[l��&@�h�:�f�..~ ~�ا�g�d�|��ȓ<���i�͠�d�,� ��v����?b����ˉ=��`��i�iz�w�9|8(�(o;3�br��h\l^�ezs��^�tˆq���pk mt�s;p��?com/storware/ipsan/console/control/calendar/swtcalendar$4.class���n�@���ә����|�)��j,e��mt� s������[���v� h� <��5q��p�����z��������ѫ����p�����c�ǂ�e�z����c�gql�2/l6pi}� #ckr��[�̦2v)�der��ng����.66zs� t;6!��hzu��r���)��e�/��l���� ���p�iu�oۓ*h�s%�:y���f �yor�2�d>($�)r��n��w��e��h�if���t v�q�s�ji��xt��7a�ĩ͵齤b�&>�bա���5}�� ��&.�s�t2u�'_w(.��_k���o'�)��o[:�g���!�\p{�u�k9;nky�y���>�h�f�u���㷎�o���d� x];�x���w�u��[l?�"�k�p ����`sgx�5��_np�~b%��x���˸r���xo�ۀ8 ��b�b��������vq�0sjඔ�� pk mt�svf����?com/storware/ipsan/console/control/calendar/swtcalendar$5.class�r[ksa��is9�x/�n��1��"�r�p�����>o����ݰ�m�!�� � ���g��'a >(y�ٙ�o���?�}�����z�u\o��uܬ�@-���z,�|�ى����r$�� #3k�-(���bf� � '�g���c�mmt���,���p�ڷ9 ����'�cr�����rѡr:ƌd5jh��!�/���aoy[o�����g�tp(�v֍$e3��� �l�r����ƹ�/x���� $c{�2z�c3�3j�q��ǰk��zmf��6��v���v��h��-�1���ڗ��rϖ|���{��1{ٷ�)���x�d�4�6�3�m��u^`�jů�[��@��slk��!e{e��y������…� �k��'�/��aj��{��p��񛭁 \�� .�5�v���x �y[k$~pk mt�s,-[���?com/storware/ipsan/console/control/calendar/swtcalendar$6.class���n1�7i�n �34 ���da(��r�z�kg�j\m�j�4σ��8� ��b�w�w[���=�xfv�����좽�e� ��[!n�n��` ���v�x��ó81n��g"�\[�yb�5����m��i����?���a�j �c�6js��jߤ�a=vz��n�2?ì4�!��ȕ_ϕuu�h_k��3a��e�� �o(��t8� =�)ë���h튘��zgc1�f�'���<>'������x�g���4��!��a�k<���f�&zt�҉"��'�(o���h&��xy'�� ok���g\&ying��t:���sv����rt~장�����f��:��e�hk�;�_�ʷ�������w���j����k�x#mdr�օ��� �����ř�4zk�.и9�[�e��<�ѳ�ks��9 j}kc�������h�?-���q�h��6wq��*��n�v�s�'�pk mt�s��up p=com/storware/ipsan/console/control/calendar/swtcalendar.class�wktt���nfr�$@pcx���b�ldr�[��\����t�&!�vj�(}z���vœ v�y�v�v[�zk*���gww���ޙl��@�v�v�=�����}�9gϳ�=r@1>��σ ���nn~��o����{d췟���'��f�^�y��~75?��n��!�tp��2~��b�n^�s�v���vl<�e/:�9,�&��ee�c2�{0'����yb*k��?���cl�q'y���'=(bi?k>�!g��i�d�c�3��{6���n"�,���/=x��n�;ǘ�s�����y^}� ��ɼ�×�����2ͻ½wx�%6��s=��� =��hd����xl�i𬮬��f�ʊ�u�* #��h�p#f�n�(l �l�zwy��re�b�a�"�����z����hy��ǵ��i�z�1�á������pc�f�5-!f/%�z�hj�\yԛ1c���q-@�j$$&zx��á��" j4p�n͊u2�ip;��j/�xer�ley�ցke�ka(2j��;�k�zs� ziռz �r���3�:�v�6�k�5j}�fr�u��u�![���h��z��[ s`��j`ir�hf� 퀚.�) ,b�z�z�p�v��#��z��rxlu��&u��j���ˌ���1՛�65�j�t�&mm�d�v>�ɻ�_�4;η�.�� ��p��ox���ݕ�*%ut��bm)i�nf��|3j�2!uަ���2s�s}3�{��64���:3�{x�jh6�_����6(�՚�6--c7�z�ʱ��6'w���.a& ktn����1��4���kc��bv� ��7�xm��g�fw�g �xljaa��cw)۲m.�5x�7��p�t��������6n���,���ߤv1c�:��n��"��[�ami��7 em6k�]8�h)�  6�z��z��g�����yr�p�tp�����z{}�xz��װv�������q�n��0� ��9��o*�=�r�6�r 0��m���od":s���; ��w�0��n�p�'����;� �> �s���:t��i�_%΁m �ұ^��u�����0���n��pf.s�!�א \�`;���o���o�� �^�f>�q���/��ŀ�d��t����hc`msto7 g.�d`�w�j�1y����m�4��b \kd7��ѝdn ״�a�w*�ڴ� �̈�7q���>��p��d�;"�hv���[0��~�4�=���r=����o$)�ǯb�3=�����bh vh���:��q�h �_��h��x�9 ��6��l���f�ht�a���i��j���h"�\�襖�'�e-el��g��z���$���������t��0q}'��}����h��'���5xk?�jid�::e\b����oo��҃#�����*ֳi� j@xd9���� 9�-]�f��n(u]q��:�)�q^��y���{q�tct��n:%�n��˶� ck�^��gnˆ��rub��%��l�^wu�[�u䌟�s�m]�@�n6��ev����j�#�''�����$�$> j���l�'e��d@y��� ��p��:��u�7��y]]��n�!�l� >͜�θ�8f�����3�ǂn�iٞ�u&�gqpfg�g�3��y�8 m�"62'��氘���q���i��y�e����:���!���ƅ�v*�d��;)� hl•���b�^g��i�﨩s��a�� ���(?(�d��1r[7*1ː�*l�՘������x�e���) wsn��t)%) �)� j����)�n��o �єdz �p^d�j�f�f����h��!&eð�q�t�-r�j��&i�)�%����n�&ݎ��~�!��i�)�`��*�i�b��o�k��>l$��\�r�tb��$�^1�"&fo�i2� ��!�ꛉ���&c�9�p�,]:*��s��ein�������y �x$�d�:�qk7��h�f� a��]�荹g�?@l�sm��l,�'��v���w��щjal����k����� s���\�z�-�#�{��8��q*p��2���u=�ê�����8.� b��9h؂��m���8��&�}�(�݋|���yr �4{u�xl�e<�(m3p��� j�'1o�ϥ0z`1ʠ��7l��oƶ��9ip�e��/a�������e� �����w����4�`&�g^�|:q��j�����7͢ge�eo��''�i��θ���°b�x�%��,��$͠n�my��~��^oa�nn���/ ��g5����7���a�q�f��� ~���8�-� 8;�q���%�-����,��1鸞�'���5|]�q�h��[��x��� w��ǧ,���s�=jߧ������s��xy��-�v�v /`��_���۸�r6�i��ʠ�;����ra��x�����(;��lz���i���czf*��o�g��r.�6�%�����f�]����gȇ;��^ԉc��b��o��-��ӭ�d��?pk mt�s�msjk ccom/storware/ipsan/console/control/calendar/swtcalendardialog.class�v sw�n@6y���jq@z ��v��<�eh��m_�d/a�f7ݽ���/hgj`�l@t��� !����ɽ��|�;�������u�0>�0ǭ����y��q,�x�/u,ⱆ'�:t4,��dz�|���fh:�(h�o�mq^k���`e^�i�2���{y�a�5���9c_�)*��p'_�kf(�`� ���c�3 ��.��"�]�4�g[�y|v�k��k~p����p~�zi���fѩ�]>o ��h���9�õl��&��䊛d��t�*�y\�;=���;�ۜ�l���r��ʃ���ғt�'. v��{�a�xwb��'�dޱ\�*i��� �o�ȑ���lg�̰ptds~������(��=�85e[�edfb�ެe�8m�{�1d��qe�q͎�i!�d � �(���^&�c�w��ݱ3�mk�u˫r;{�k�'-���wۈ3� ƞ�fp� ��̡θ.c4�>d�xt���m s�-�_��1vi>��s�vr�w���p1`�kx3p� ��7����1�~׻��֖������(���� sh`�\� x�in�qk�ri��dz�h 4 ��m�xe` t���4� #�<6֬ 7����j���.u�y��u�֢,�!�$f��ֽ=�;���γ(�0���vtb� g w�18���ұ$�i.qg2\{��(���j� ˨h�m���������j��n�@[*��a �\��eۿ�ey^ݠ�p��[&�s�^(,�b���<��jn��n����|����/�y�ձq� �����(�))g�>���� y�n��% ``brlb�r�g��q�e~�����)\@ ���[&2�8&u�d�@{1��-���bz�'��ki;�7�؅^�$f!����6�4q�'˹թm�^�?1���&��l������&����fu�1t��q�b�;$�k�#��6�<�4�]���b���6�[�)���}/2]�ݎ�cm�x �ɕ�¸��@\ro��a��dd:-$f?�n�쟓�䜦��b!7��� ���~irdxb)(��������m�֨��qjbt��閳�@b: g����e�8>�=�n��x(���pk mt�s6���� bcom/storware/ipsan/console/control/calendar/swtcalendarevent.class�rmo1}n�lӧi)4|����4�0b�z�@j��cc8;�vpq���ۈ����heh\�a�ζc���ec����q&���>= �����x�}�o 7"y��lv��s�d�%��\k�;>���\�lq���/ �p��d>se�����p *ŏn2��?�����"��g��9�kdx�f�f�m4��sd�p�^y&t���ʄry?;��r���3<>�g���5>i�������/q���p$�t4�[4����s��v�*�3��{�l � =�v�u@�z�w��� �!�$�h�!����k}�̇b�"��x�yz�n��;���[¥ vl�ku[�����?`aq��������� p�os ׉�陸�zao�\h�pk mt�s/�mm jcom/storware/ipsan/console/control/calendar/swtdaychooser$daycontrol.class�v[s�v�t � �j�\�$jsi��҄[bj bsid[�"f������/���}mf3-3��c�:�=��-&��c�juη��������"s�f@c�*&4�c2i�.�o4��=sizn��tcf;����*>�#{��b��5>��!���m����3�� �?��ʨ�q��vyl�z��2��q�fٴh�ǝu�aq�2f z�m;�"�n��:vj��ce�tz�7w �����dv��e�& �߈�7=v�g��f����*��uxs腭�~�f�[�gs4yzv���fqׇ�k<�]/t�w �|����覟�$����� .az6һ�~�������k�?%�p����54�կb��j ��h�#9gh� h�kh�h�ks[נ��\�j`�:�"��g�(�����6jm�s��j[c����w��w/�u; je���fe쏟�y��c/d��i>�~r@��"c�8���ge7d���'pg�ĥ�ŭh��# b?���i�����/�,^�s�m�ǟ��q�|���>&β��b�n�ѿh�"�uψ��qs� ��(��ak�!.�q\�.:"`�.�k�,�h��t��;].ӕq��*[���uɤg��i�����t�k��;��:�؎nė�t!�� f�,f�.nm���c��#m���x�-���7��p-� j}���&�*u1$�����o�g�i����y���]��|]۹p�7q%�\�*�(n�\���4��%�qlƿ�e��m|z�o�m���i�1��;��st��wx��pk mt�s��᪛�hcom/storware/ipsan/console/control/calendar/swtdaychooser$daylabel.class�s�na�f{y(�upj��r�u� ����i5&%�7�nڑe��n)�ç� |m $��>��̶/�m�9g���w�3����v����m�l�s�a�m�q ׵��3l7m,3$ץ'�}�\�� [8�l��;���zc��.��-?�j� [ �_ ��ij�nm�����p�w������øjʐ�o�txm� v��dpry �lt��tx l��=���w��*�]�p�w�]}�ih���"�� z�fzt�s 3g�!�m���@��du����|����h#୦tb��/=ef�aȟ�����t�hm*��z�ir�!�tx�a�����zz :m��t�5g���k�su�8⑌4�m��w|�[�0�0�'�dȝ�o_�e�,/[�rn��c�.f-�ì�1��xex���!�n�i/>���;&���֧��ľz���q�� z�%m�� ��(�ar��g�l�iru�k!�w�ylcl��c���ʴ��5 �g`�5��5efic�<���i�����k!�]�(e3=��;đ ���������k��p��o0���� d&�g����eg�5����i#��b�؋(�p,m^o��dr�y��me��t{�� w1��h��k�i}`��*y�`��l��a8�f�b�pk mt�s'���c2?com/storware/ipsan/console/control/calendar/swtdaychooser.class�z |t����y��&���ä@��*�h� �ʐ ad��� w �ժu��up����[�.�֥�v�u���v�v��y����^f& .�霻�{ιg�������`��dtdj�o�۷/�cd��z2.�)����k&� 9x�,9$��r�˓�����u�p���tk�0r���`��� f)����u�lk�薹^�l��1�� `���`����e�.���n�#�b�t8_�ld]���*k�w�饺y��,�^���,pp������@����,����ګw�’tf�vyrb˥a�i���=wu*���<��� x�ðd��iޠ{�feѥd" �)�f���h���k�4�m�^l{f[��&i�ua*=�<�md���ar8:ҟ!�7/���h�x,l[�hs����u��;�������qzs&��\��h:*��m�_%��i=n1���@f�� �i,��l,ѥq�lh�i�y���ȥrgj�����&��;�j��lpu�iuћ�q��x����m�e@"��5ߟ�c4�.^�̨�4�������{a"�>��se}$�ħ �ٹk$��o�a�lո�eqy��bէyqi\sԅ�q�v�0�u���{�2�í��胦n�*x��m�u�~o�l!�@}�-�y55k����?�6���6~�[m܌m�&3�4�u���m��m�l� ��[pҵ�*[�'w�r����l$);m|o�_�`�\��l��ֆ\g��r����f�~k ��a[�/7ڲ �l�i�� nq���y1 z�������̖ɏm�mn�g�>u�-w�\r��p����*mlǖ�ǝ~�핰l�.[v�ݶ�p���=�� ��r���e�g�j���-�c�<,?�q���yԗ����}��� ��<΄=h�� lyb�d ���[s�� �_��kyܒ�l�h���׶�f~k���[~/;l<����f}4x%���b3wz���h� �[�e� d����*��sj����[�.��a";m'_��v����7�>���2��c�7�~j�^{����ѝƪ�l�6��]m�'c����|i�2�m@���b 7�k-�9sï�q�� ��7d(z[kkr��m��w�c1hmkq�&-�ds�uy$ڼ�w�g�b��'�gђ�x=��|�ugie�fl������v�����s��l1g=f�i,n ^�ud/�)�qn����xon�<��l~��������b�(=���jpp��ǻ bsq5ww\����:j� f>xd�l8����)�}�� �o"=¼�� �����#�b�� �g�_> �^���v���hd���w�_?�yk"�q����d^���xkv�e{*�d��� n|n5��r:�|#-*���ז`�9�j�~} ��"-^^]��8 ��at��g�ڤkpdp��a��%f/2�zw�f�,os$�|o�1��;���io^z�o�t��ee�s��<o4enz�s/��`��mk���g���sbn� ����7er�hl�[���z����g*hc���t�&]ؘ��k��і��s�-�԰fw��kz�;-�7�ǻtg��i~�/�<����䒖�)ބ�d� �h��wiy����k?s���}�������~l�^�gc[b��"����b����q�~u������q����ɭ.��3v要�`���b| ��ÿ�8� ��y�z���5�6| �>_�e1mz>�l{���p۝n{���e`�ܖ/<��uiڛ]z��v y�qj�c�� 9��"t^r�=� �pi��=�i��ձ�p�y�n ���� :.�y��]����g�ü�03:��fp��� �ƈ��ȇ.pw����a2 ��v`��� j� utbl(h݇q(����bw����p��k��„9~� ����{0��@ѕ�:qp��\'m�ɮ}���!�/�1���}��܉���*���߁�b� 3���:qq�s�ġfs�a[ ���=k���`�>l���n��q�i{0�!ԅ�f�i=$�3�0?�އ���*��:q8wf��(��`���<�%{d'���f��g��`&a�p�q2fa5&�t,��0n�zdј�g��,��|�q!6ҙo� '�i�d�n��������n;��|ޝ��p�8����牅�e(�$#p���v9_� \$sp�,�פ�� |]v�r9 wh���� �ߔm��.�#;�]n�ur ���q�tb���ny�ɓt��tg@_�cqn��=w��}�c.��]�q�i蠼~�e�|� ߝkqov����{�����t��4�<8k�ý����?���o��-���d� q?��h�c� ��v�̳��rm�6/ڍ�x��"��b�zԉ���k���y{��aq�p];�g����yg���t� e�靨��s�s �r�|��*ʙ����������яwѯ1\��@]'�َ��4qc��ȟӊc�w1�w��ow �����*k7 �l��l�c[ξ�-'��/��vb(���ϲ#�!;�:q�v 7�y��/ v�6�b�ɪ���7`��k��ߚc .$� 7�  o�f���x*}2wf�q��� h��4�qt��4j��f����l��os_f�n�qo��z�p7����{��:��xo�r��d��r�v���p<#��,�sr��{n�4�!���ur����.���j��o��"ճ̜f�z�'�ax��3�@j�3:�n$�b� �l겏a %szꔳ����r���'- k���{� ��d�#z��� � ��:g:o����#���s_ �!v�ʸh �в���u��� ���'�ī�j`�t��s]xӊ��m#�as�]�fd�/��?#@�1��_q��c ^�a���%,ÿp�w��_e�}�{^��x��mfطy��c�{�f}�y�}r���s��"b�w������b�i���i�0��3�j���1���8ם�$��y f��8�����f����x��|��e�ދ�~��$8�n�ɥ�ary�g�{�[��kr���q�rwbdȧ#�x�]�yom ,�;$j2ҡ�?� f{�qu,?�h>��s�˲�ey� �'e��a � ��4�ҟ ��t�2,t'�v�g��s4�n* eqh�=y����l22�ua���ޟlt �_������(�m�%������c q�d���\?}8�� �q�h)��x�\7z&fq is q�j�7���� ���vz�]hb`n!�ȫpn�q��ale���ۅ��c%�5�(�t!� ��&mf� �sp�����`��4�nd)%��,^4�l~i��3���� ���ki���w�����n�fs����<����$ 0]�囔%�ai��)�tv_n�7���3�1eȳ, h����� �,{�gұ��nq��7����z^u<�1lǧ%wn���� =��l,mo�533�f� f�o�t�u�>��'h��́ga(:s$�#���g��əx-ga�������\��~ �� y�_���mi�l�b�v�kj0xpʉw�u2�{_>�{ e��}�%q��p��kܒ�hے��7�_r�vkė=����t;3ڕ����ѷ3zw��σ���t��ҭ��:}�=l޽����<�w*��[��^�g2��h��k����x=l e��'un=q�txѣ<r������:pv8�u��jj�$����w�{;qt%�����sg�4 2��!;��e���yw�����2��� ���o��ŵ{f��,=oa@܊���"��(w`�܉�t`_ji� ��f����p�<�{�!>��o�q���6�5��f�ӱ�������a���u��ȕ��>jk�2�z�τ�c�y���l�h�n�~[/?{�h`;\n��k�(�l��tkb;�2l,6��� �q�r�]rn.��/f e�f���;�7ݧ�gw��.ݤ�ǩu"ys�( �c�߭��s5����� �–�xc<ϛ�y��/��/�3"�{lo[# �o��!�crs�r�y�������lp;���{/f��6�-9��ַ�r��ŗh��a)z���.ŏ�p�i�x76 �d��o���k\vg��j9sj���ѕ�x8ۄhω؍s�ځ�*�7q���|��d�\�pх�w���<��;ӿj_c����� fֿ1c�dd����t��x!��y1�'�鈙�����zvը � 2dwi�0��#l�d������|v�� ���!�g]��0����de�r��x��'*�`�ubv�:�ʋ��^ɲp m���f�6/d����t���py��dv��0\[f�n\h��j&�w�~'��,et=ako.� ��qlk=�(� �l�s=i�zt��� �� ��γ��d�o/,���l��2rp�p��<*{)s������� g��lgq�k�~4���l��pk mt�s��b/� acom/storware/ipsan/console/control/calendar/swtmonthchooser.class�ukoe~��vgw� -p�rsh��add u(v��. nw_��3ef�� $^m4�d�$�>�ldk$��'�ơ�;l˶���z�s�{�s��y��;v����u��ag�f�p�ptg ��9�ᄎ4�͛|2�c)nj8��[|�6��� ��x��q� �p�a�8�2��xpx8��yv?��yk���@��wf�����ڜ�-yt��pz�ddm:���bk�e�r�_�])�4�o>�%�r/ ��w��(��2��6?jqd�[�u;9�2 �2�u�<˭�ژ��j���qq�zb�^�^�`w�{/9� �zɵ�=�'���2s�fb.��{c�d�7�$�t�=�deя��l�b���@[3�w�ur#����f���py���:�-�#v���4�#��4v��k�̵�<`�&f�b���-$��h�a�����͘a�tskh�h�����5�ր�u��и����h������ڄ&u�s�q'h ��[e/��ڂ��s �q�7ч�s��|�� ��ȑ����$��t�l�l�`;�} e�y�o��hp)n;)y����ct�%�:��i�oz�']�@==��ǘy�w�df oְ��g��i��et��%f�t^��pk mt�s��w)��5com/storware/ipsan/console/error/errorhandler$1.class�tkoa=c k�ejt|��xz`� ���v[ll��t;�k�;�����(m��(�- fi mzf��s��������u�����"��r�,s` ��&�dͯ�����'|u�%��.��b�˪�]��3���)�hnk�� \_�tے��fa���:f��&�u-�up�f��s��tf���nő>`h7��uu����c���`� l�io�ӓg�'�|sݓnd�:1�ma�z gb����p�ʇ��v�)|��l�w]t���.�q�z�se�ts�3z�>դ�ܐ>�l��dǫ�e�؁*=���k�����s���p��|wfo��f� et��t����h4tkv;��%�!0�k�m�ѭ����ɠ�[�\� x�}c� ������?��%z.c☡�d�0��w��l����x_1p�t>��v���'��8gx �wd��p�j��x��x��e\�uk��9��&q7� �>0���pk mt�s������5com/storware/ipsan/console/error/errorhandler$2.class�t�na��v�.��"�xa����d#�ؤ`�6n�c�d���n/�v���c�l�`���ɞ�9s��μ�����'�u�l�Œ���k�� �7�@v &r��ţkz,� �xenqn(u>h�l񐷸��j;�����x��d���}�䶬�ѣ��f�,t��}����}�<��)�q� �b���0�\-��n��tm���5bخ b� ������� *�psk�xb5�y�c��w�aizv�㾬ڻ" yu��b1�t�x�i���&yַ�{��/c����j�b`���[e���� �xh�3�ku����a���vj� c�޵/��ro-<æ�md,<�b /�ӟ<�>����p#�֩�]3��z�2�ur:5�.5ğtu�;o�5ik�b����k�r���".�������@�n�s��0]�7�m�rqh�����9&m�؇8r�늈3d���ݞ`�?�q�j-#qit(6&�z`�"�!��]� 5�.��ӻ���c���� 0k�\� x��b� $��0aҋ�&&q�fj�zu$c��h���d���|����c��/`�0��>8���%�-�m|�p�|��&�p=* wq7�,av��mlә�ܥ=�=���pk mt�scq��%� 3com/storware/ipsan/console/error/errorhandler.class��owgɵ � �e%�ڪ�a�ul���%"fz�z��͐,.�qw#����j���k�d����3yz��td9]3;7�޹�7wf�����x��s�s�5�ȩ8�݂�ȫ���a�s0�b�xw\uцs |�b�p0�����7�6��p�sq�|�b7n���c�� �؃q���q[��s@�:��2����h9c9v0(д�.ϸ)�-g9r�2?#�icʀ$�smþnxv8^ƃ�ez�t�u?p�ó�u� g7]�wm�k�s=}$l/n��ހ�vj�%war�,�n =ǰ:�h�]o>����y�ʦ��߸23���}˔a1���rs�}c��-}bλ�y4e9�\�(����� �z����t[ˮ�[�1! �ubt�ķ��|�yn�z-�� vp�9�̺m��0�刦��_��-y�(�%���k<�ͦ��w\@ͻϋ�p}:�b?�j؏ ��yi��4�a�4�`q%ߓ{�ƨ��v���pr���es��v0�����:��.���v�ij�b�� �ꦴz40�^ < > �w��ak�� �vx�f^�" j�?n���uz�xh�' ?� �����i�}g6e!о:/z��k�:�cx�slxta��6y�a��y� bq�(�`v�{�-^y�b�4�l�ތd�������fw��7�փo��ٷ�^7�za9���%��e�gj=7ca��g ��zf��u"h���>���g�an�u���}�#�v�;;���\z�ry:��y��v����űl��e�x��3�]wjj]�^���^� �ҵ�����@_� l���[~�6�x�px��u`?y��b��:�'ã9�/9�ȣ�=�k��d�q�c0rj�x��n�`}y� !�t��c?���yv� c�g'��8a�����a�*{�����9ߴ���aߊc ]�=����["��zq��&�誙�'bl�������2bɦ*⿣�7o����؟h��������.i�wūؒ��^�m�9�&�-�����e$��η䎰鬉�u��/c�k��?gw�g ie�d�|���}��bj0dg� ����s����o�v�p�q��yl��1�ǹ�d�'���2e&l�"bop�x��<<�/��x��c��g;��,n[ ��wh(8� )�ux��v��o�����*��� |�kp�_�ڽ>��������~ٳ�����mb�e$��1m�tc��!�h�ik�ٴ��r�_hw��a�7�c���o�pv ���)����g `� ���vjfe?�}�f��> ~f�pk mt�sk�t<�2com/storware/ipsan/console/lang/langloader$1.class�r�n1�����vۆ�r~zr mc�b9!�$�����9�q�ڋ�)�j�� $(�@�0��6��'��{��7ߌ�������|,��b����xr�����^�p�����d)5b[�`��w�>��v��5r��3�ߒj�� 'k�?/o1�z�'f�r���^w����g�c�lq#�}�,پ���j �jx� �6۱ދ2��snd$ӌ�(�*ӊ8lئ��yo��u��dzh-cu�j��l��4>f(��a��jb�#ms��<i :z`b�@��.�b%.���!vih.����y�k�k.$�b�#�b"m��[� ��{^l�z�ޔt\��t£ŕh}}a���ɠ]ǝ�� ���ܯ�iw89�*(*h�a��x�mi��f6��;f��f ɧ ����|����f�:���a����ˢեx��i=�ڲ{%��n�n���|�5�jy��pg,n�� #u*�r���h�g=xt�=�a�,��=6���xv֣;͖m4$�^f�|(&ɮ\w�s9��䛊&d5!&�|!��p�"u#a����v������fu0a$�� ���5��r��x/`ŵ��$�l*�y@6���k.ن%qn�-�@��]f�,��y`��}�,��ȧk�my�w�b惪 �����5�~�˗[���c���(k!��7�q� ,��p6b��<��d��h�)��/q����p���~�m�(i�� vv-��� b}^���j�x�k���hixc��� &����p��|�%�(�� �ʏ��b�c ���b*�:��d'<�1<�mv��5{0i�� �x��w��|�������=������֡�� ���ۃ��7p�,b����^��i���/gb>��8�(�k"�od�@�.� ����"ip׸x��$l7zh��n�b�en�[ӊs��o6o"i��cm"|pn��r�x�m�<���o)��$ó��זg3�ݼ�� ��o�`��?���b��� oa�wqolj�h��)l�h�>�����g:��s3���p�t sj�o� 5�#���‚�5,)�e��(��5<ְ�a�!y�r��cw6�ɛ�uk�a�`9r)�)joum�i\s�k³�ss3lz>�;��fm���� ��c���մ' �� �0]�wmi�©��ܚf8s�j�h[��,1�f �w1�i��4�z`�=���x�3���#�������џ��p��o! ee.��-�'bt �g9�-�u�$� �0�e5bo��0c(�"�q�w��3弥��ߢ;�|pp��v}km�ni��5�s�� ��x�g����ζ##����  e%�2g�,�-���3�e��ǡ�x36vo�e�,; h.g�v5��0dڃ�� �.��{5�2�۷�) di����������e����,?��b���e��i� ���x��t��ce���zg�h�rto���ds�t �w��"�,;�����䝒|�\�����\����~3ن���q���]r�!��4� =��y�q�pr�����5��{�xԏ�����[a`�f,gv�:��'h����������v�c�>~2���gxr��*�s��%tn�qx�-s�:��pg� ��1!�蒞tk��ta�8�օirdf&'o3̟^q�wt�5�:�2�:e��i\�����.�?�bz��a3��g��kzt�]�ѧ@�f �=�o3����l������7gwݯ�xk�ԑllԡ-5����wl�7�7�w71����� ��3u ��@�, u�k m�� �w_c�� �s�7 ѹ���2��p�&���݇.���բob�`a�x���;x��0v���l��cr���� @��l�*�����;j2]dwc���8���j��c�dq6z�tp�l-�z!>��ś�� ���e|@x�������r$��pk mt�s&��y�0.com/storware/ipsan/console/lang/langmenu.class�w�w�~�d���lhx��-�p#l6���b,(��ԍ�@u&��00�ywf!�^[��j�emż�j����p�#��{�?���ߴ���r kؓ��n��y���~���6��fl�#rxtcsqp��a���8, s���ܴ5�9s��� w���)�x\c��q��/��2�j8�y�5$�?t�# ����iz�q�:�(q���y<��#|,��� ~iu�t>�1���z��� 7�m&�wme`t.�x7������o�>����m/ �q]h�<#�����js�-��6ґ��ږe��mo���c��ƶ;�ik5:�tymw��d",��qߏb�m���2m��|dc�,�k�� ��j��>;-� �����$�� 7zkq:f��k���jb�v�x��w�jf[wi��e�`x#�|�.���x�p���]m �j���~`�����m�:j�t�pb[�!��f�d�������bp\�܂5�o�:���t�_����)����#u{s ��kx�y.�ςo���~��i� ,�;g14�ϝ�n�ⱦ���<�rҁ �gpq�� d_ �p�86smsd�����w!��t���$��l���g,w�h�?�%���,����� zz��a���* ���m$u��m�ɦ v����p�q�ڡ��n2֡j�ɦ�v��/ 11�u��t�u�c*�i8.冒q�x�e~�am$�����gḁ$ }��o>���_> m���n1�;g�b#��o�m�2c�j�i�zd ��v�|]؆[���; �.����=<��o�!�q܏�c�w'���~v�� ���_�iz{_�i�o�?x6$b�ԝ��oc ☠�;���}��0�m��v�6�� ��o���a\�i�8|܅�i�w�߁��� �v;ǵ��1����\�@�e�i�wq�e�w��v*���7\�x��~�\�j4d"�v1*kc/s�j�#i�vk��tdn��� �����.zҹć��h�; ��ow* �et��}�uxi*s��0���vz�u�4؇�[��&�b�a��ets��,/�٭]�p�p��n��6��nt�ݨ�cό�_!==|��wh��7�k����/py��(�~*� �s�q��ߠ�=�w�l���g�ndx�� �˄-� n~lq�d��i���l�4���h[�q�b!����[0��� fjl����*d8o��l��clw�]\%�i q��� �u��b�o8��0)_��[���n�8�u���ii�b���$ij�v� ��ho��&mû����� h��<=��ݣw��#��)�e�dds���3vrkfq�60�-�j���7i�#t�]�q�<ؾt.9a�`�b�)s/os�g�pk mt�s�i�g4 0com/storware/ipsan/console/lang/langstatus.class�u�sw=�6y6 a�rm�-�g�b bi!&4� h0b[k����a7��h����v�2ӯ��������ml?�{{���{�=�����;�)�t `&�s��avg3��� ������f԰���(r��̴n3�c �j�f����g����q9e�����5����_�zio ��g�c y���d��lgwv �r��o9~�*פ@w��y��mfլ]z:�l���b#�e�p��qq���|m[z��vy��ݒu.z���3���u�q���'���=�<�� u�i���-�za*_���z�e�w��:[����v���}#o���;��q�'���m��mg�b�{�ڪ���9����f:�no:<�kiv|�uf�vϭ�חk�]n��#=ߖ v�k?�j@�ξ �>�l_�.c��n�tnp�ܚw�����7\m�l.�#1h�z��֪қ�s�������fd��x��;�3pe�1�a��& |�!�tx��~������<�[�3y>�hb f ��pm�'�ν z�~$k�)w��ӯ�u_���s���w[����:�je:;ﵣa7f��by�8��1'�l���v���v&k��� �4{��8�ei����k�޽.%�v�c����?qvw�����y%n��6�5���٨�f(�����e���� �xs�a��0�z� ��uϕ�i��l!�=q�"��q� n3� ��z>����� c�. @�%ڞci�r�dy�y�o��mgsm0��t#a�q�����1!�gm"�o����"�d���dg0;dwn��w�ę���f$���g�4��/��<(�:b&��pp�uvܤw]��5�қ�<ߛ��m, �e��k��t�!�j��:p���8q��m�ʳ�$w�����y �5��zꄵ�xt��z�5�/��y� �xk�� "7��=����u�"9����1�v�g��m�����=��h����k�����e�\ x�����{9*�m��`c� `u{�팑$[����_rئ�&�c}��|q"�k u���f������@g��pk mt�s�2�� �0com/storware/ipsan/console/lang/langupdate.class�w `t��f���㑐��@@�ͱ�r�e �n����zq�y����g��j�z�m�z]�zql���kdk���v�]e�v�֣�պ ��{os��of�c�����l��xq�‹�s�slpq np�f7�*n�f��e�n��m*nc���r��*4lv� �v��;ܩ��q�[[t��٪�w*jq���u�!����wp��jlsp����_~~�`���*v`��=��j�)xxe-v)xd�������c.<.�?�x��?k���ȓ�������l�{c�d2j���a����yf��nz�c���t ��&09s�j����� >mo3�h� �5���_��4| �h�p-.��¦ �����vai�!���es"`c�h"gp��ɪcm��s��p�&fa/�1{� tf-&mhx���� ����k����o�y�ȗ*�9�# 4q(��lh��!y���5�&ƥ3�yz8l!�h5#��4q,�q�e��n�x���y�q�u(�d�w � /��ѓy��a�nt5l��f �qid�ӿd0nf�i�pd��٠��=�c��igt�����fk 9ܖ�� ���!��(��d�z1v�ӹ������u��m��1z�[aum�h�b��!w���c�7ɲ�����ٴdr-��}�x�b�f"nܘۣ�v�7b�cv\;4�f˓1�@7����hݒ�ň%��cwf��q=���'-�k�tw�/��͟�v���@�̫�:$f�/�c q������l��qr$ߪ�blř��k^� 5�@���}u�'�}xex��(�m3�:��s�g�z?7��y2���ŋ������k/���d@�t���(8:��@l�ć��u9 p� _�l3�p:�p�e��בr��� [?��:��l!����s����od��,�n��b�}��v��� e� �5p�;9��g�q|8�a梞��x����.c)���3��:�� }&g��m���\�op�9�g����ɓc�^�.���$[���� -���м�)�n�/�lؾ� ���vj�a6�./�&�i�<_��im �i\f`�ԇ^b��xš��e[b,���d��$ i[�֘�8c')�,����i��9�lg���a��2g����)}��r���j��k���1f�˛���d�bbh��bk�� ƶ�q��_=gы������e��)8���s.g�p���j�� ( @ia|ݼvf�q\��#�уmxmٽ�b��p�÷�b9��ex�������:~�k�f��c>&�ј��z�q�9�j5��m�b�f��>��9 �� ��u�~�w3a~tr���=nj0:���;w���і��]g��i��9hwȩ���>3��!/lc�r��v^�w� b ��â�(v�p�#>gv ��@��^3��q����;�f�#2[v�2���2� ԓ^�� ƶ��t_�b���c�z��6sz�`��a����tf��6\cl���1070��i���`>n� ������w6r�3fr��c�ьo�c�7 �t�θh�øe����z6>l�8ô�s��q�v���b�[��j��i�����t�nb�2 �b��8pw� l2��4lñ���14�4)p�aҵ!&����v�i�iry:l�4�ǩ�ӆ5��zq�m�f�v�p�ڰ s���{p�u���� =��0����g�0��e� x%�1�30����id����f���&"g��yrvy\.'rn]dα��5q� )̓j[���),hb6�ƿ5~%�f:jh�x�p��bs[�ey�m�sx�@i�j�jib,e�z���c�`4l�"�f4���w�5c|]l5f3�[g�a��!r<�"�o1� �i�` k��c!^` x�m�e���,�wx�{x��"���%l-�����e|%��mx�fn�;̟w�'��o->ē���a��k�>%�g†��c6�c좘o�2b��� �^� @2��b4ur�����t��?`�lan�#�f-�$�_[�zή�� ���gш�������shq��r�o�.�����9,� irg�&�̬��؏ �q����)]�[y:��(�mֱ>�,�n���i�v.6�����%ƈ�ƀ���1j��@�1n`���#q�(�s���:��@t�rtb���:1 ���g���:�>�nu֩2�հc�а��pk kt�s�-ʎf�>com/storware/ipsan/console/lang/properties/messages.propertiesܽks�h� ����?��l�� ���]e3���h�j�z�(u[�r� �d21by)���o?� $ȫ��۲n�dxx�=�=�q\6�~[ԋ���� .۾[ue�^�uqyֹ銮ܖm�ȳ�����զ3پ�.��\�a����2�/˶1m]r�#{`p�um����d���ޖ��r�_�7�����7�ˢ���m�ew���y�e���z�����>��:˞3h��z�]�- c��&_���� ͦ�q�ey��.���s����ҫ��,�|y,7��{�#;�?,ijh�e�8���m���8ş�[] �au��f�ܶ�%�q]]�����ɺmƀ='�� ���h͒!=��-�nݗ} �8�����[w5����k�����)�r�-�o�n����m��f�}[��ށ�?���붆��}�x]���>ߗ�&��kpҡ�lq^���6��vu�y5u�x?`�v/3�rҍ��|?4�pe�k��3�����wt�xa��u�9<��}3�w���l�^wb��#�m��w���?y� �hrqdy�)��kwt~�@��t���w��ٛ �dg�� m̋&���kw6�ŋ/��q`�ԧ[����2 =v6��-�y�].^�k(�pt0�}� ��0�]�x�<���0k= 뢪�;=/�{�vѓ����p'��p� ��hzo ۖ����a��>���yov0�i�?�@0��?�v��iw���b �tؔe�m��;��9\}068�]�/y���r�o�2�x׽�,^�ϰ`_^�u�ʋ�kp�z���kl�.�e���t�.�z��.�{��ooơ.}�� (.� v����]� ���"\c:r�et2_ov�ާ��� �-��e@2ag�� �x%k8�(���[ z�� � �.�_̳���������x(>�o�q�����' ���ƃ���cc �|<��~.�(�k�=f\di1�b ����j�f� >gp�w$ �a���dp��_�wm�n\}�6 �o�\�����n�m�_)�^����-=�c���ʟ㍝���#��9��m����[���t �w$�*|y�8�&c6 ط7p��/ �� v��8?�!�ɮ�3lh8"�w9�pu�r��;��9��$�;ɢ0��k �~���b18~���/b��fvu&䆮1d}bx|dad�s� �ߪ�=����ϝ�iz�p�ކ|�i �&�b�_̦��� (ư�8(�3�*�����l$�5��d�fx�w�s�!yf��0dri����:��,���ocئ� ߶7��g�� ��(�)jk`z�`��؀~��*�n d��@�_c�o�j �h�p������ v&(صu����s،��������oۀ����as}c��'��}��h�бxg�t��� ��" y��іnd��!f�&���l�(���.y��ba���{k)>�?gk"2���.q��ڲ��c�,��]��fy_����v�*ya���(pw ł ��p�sь����:��o�ۣ]�i�".=݀���[�v^�m�\!;��v�r7���7-2��4;�w@w���� 9y�sr�~�o���b�gܑ- �4��n�v�]!ܿ>0���|s5p��x'g�덹�/��bz�u��e�e�-�-��v��7��p��%��lg���� ��2�eeִ��h���u�w���և����w"n̸�𤰸w>@ۛ��9�:ԗ��1�0�.c� ��k��*��l���?�՞x�vy��(�-���-7-uh�h��: ���2���m l�c``��ίl��� <�� �g��*.'�a��p��p�̄~j�o��ٳl�-������o�:ht��! � wj��)���[b�-�u�x�>}�}����绻����v��?��;���w��w~���"o��t'a���q<����˪��jk����~��������� �@]m�n��rm�m��(����.�`�h�\� kv r�2�w⬊��������'3��ߐt�yv�o����t�@b�p����&j�_ps�b&�)oh�w��.?�yj����~2f$� w;/a�\������rz�|���nr��/,�p`�c�u��2q�c�m ��_k붹�5��=p���`�tjۺ�v�a{��n�^�)�[i��� ��� �`��ps�uvy�ʉ"ă�d(�6 b��)v4����me�#��p������e����}��$�o;���v��n4um����w�b ���_����27���%o��_hud_�6%�/�]4y(�[�0�yhe�db�l؈�@��/q� �c�h�ٺڛ�@�x���p^- )x��<�_b��7]�@��4� �y�v�f~n%�}�x�����-��u�磻h�3�7��by�� 7�sr{�ۃ��m�� n��~�g���~�� �r�v�lynj�y�0%��d����0p�{x�d��}��$��c�nn��l^�vl��6u̖�a_<g��:(�� dd�����x��۵���k�zi���޷�>e�� ���ು�c`�f��@~o� c���!d��� ⠡�ș=?��er�p ���0p ����9�lӯ|�s� �0� u�g^��y�nf��=]�y�/�f_o��@��\��q�>�f'#�j( p�u>�u2�nl���b�^ _�0���_� ຀�6�dԗukjn�qz ={:x�g�g�z w|�amsk�y�%>�tm����c�7��fj�7�4 �o��t%��� �o34t�,=/�nrr�h�#�%�7%�/�}�� ���^4�f�:�6ev%����eefz�)�ׄv�3����b^k���e��»�*��p��yr���]dl�l?�:�� �>dw�3��k� _�]w�u8�ڝ�����ps@�$�<�g � ���a��e�ѧ�m����n����^ذӌn }���'o�y<���.�,�ru�����\��)b۷��#�u����d;2g���ԁ,d�q����j��n� ޭ5�qk���t�x.��h�����f�o��&n_�ѭ���sʸ�t��ϝ��t�f=�,t��ɇuo/ �`�e�9j��5w�������^�ځ� ~@z0�&p��p�w�.bgt=v)��pri�f|�� d<�l�p� �t~�����ϣ������z#6�6�_��k�%��b��v��b������@լm�3o_��dsx$�3k�gb�]o�0��ޱh��s��2��dd�j�ދ��=,�q�����a��#��)� ��z·ݗ�?w���m���`�֤%��@ԓsf���g�a��q��f��g{%�wb�0���,nß��m�#l>~��f2�} u!p6�� ���p_�!�|=�^�i�d$��m�v��i֒{��`����û���s&s�lj:!?�� �x���p�?� ����}�(g5�6����i����@�e�f�\f�\�e�%�c&hj�o���� &��k܆~#v׌��m)��è�,ٲ�u��!�m������ķ�h�u�������_ c���:�]����|���`����=دl� �7n�-ι��z�4 y�d��z�c���p�#c1��8������x|�wxc�&�ã( ��|�k������7�ob�y޵k2��v��l�!d��փxf1��xq��5}2��q�!�<����_9���� �7�ј~ujdht�&.��������m�����^\�d�d�p��軖��:���32�k���`7��9�p�'�: f�x��pi��2� ��������ۢ��kt]�yu���f4�>*oݻ���������֫ ؊����f �x��6�)##yw8�s�1=0ve���v���ke::4�w2��i��|�ɲ.�)es��hӈ�����4ek� rjk�q]c�m?����d�0��}m6*�q%����d�h _p y^u���_܇=�c��9�c�fa�� ��.n���.�5gx?vw� �� ��ר�^g�������r����u����&3�)�'v���q[r��'(o�@}�h[ї��gk��']a��!�*12�0����_юi� ��l��t�6�í�?q� ��a��a 7��'�����������g��o}q-�^�*ף�m:���~e�d�.r� @_�l~�wa�{�6fu"��u�>'ijܺr�n�y���׫�c�ek�7��}����%{��02cn�7e�[�?��ܰٺ��?hh���/ά05���#��aȇ�v���zg�ly'5d�urԉ��m�(ȕ|e#��[��o�s�x�ڿ��>e�xu� ~���{��1ԉ_�����v�gx�,?/� ?��y&�vo�mv"а>���u��f���7���������b8�5���3*���˒wjמ^��(��' @�n�h x 0�qv��b�yj����?w����kx�3g���q�m�d��zkz]`�d7z��h葑�b��m���� ����p�,��9�����/ab>3{c �xh��l�uu����� �>v���j?�w�z ա�o�n@}f�di�mi�#a��)�z)�z����v����%�w���ڟ1���ò満��jԍx���qz�¿p6�m���xw�k?��'r�p�o`9'�����ǡ/#� @�3�p^op�v{�"��h|'x �'�v9b��2���m���ww���q3���c�t*�x�e�����k�7ʡf���†�����me�kmr�h%���сs,f�!2c�{;:�&�p�$;,�qm���p7dl��o�*@��x*�}�v��z� �)y�x��b 1̨o/��ѽft�&��r���� ����bc���c����:,�g�{�ަ�z��xb�g ]�����1 ��:�.)��yh�w�"���qa��w�� �u��ġ�y���^����1hi� �2 {/;��d'9��� �a�{b�$'k��r�bšh��vwf{q.�����/�j��� ����ڶ�w'�kh���m�ho��x�l�*ʂ)�؊��;i ajh~k��ɦh��^:�l��㠣�$,6"wa'3/b���}{˚�mi;vu�=#��j��}�a�6j��k��{m�[�0 =i`�bf�a�*����l��)exuq��/p���ml��#�9��n�5��9��������s�>�"�a~��޳���ݒ�;>�[��lu7�93ޞ�m���p������v{�y���[��z|����#����ns�ߺ�j-d�s�9�����ϣ��r����j$�3���׽���f$˨�ax格ڋtb0,�4� i7��u��;�adq_���� ���z܈3;v���#9 �d;~ oc�j�!;��7g�e�����6�^���ո���$��� f;�g�fx�b��cu$��q_a�w�"#� ��\ٯ�5$7x���n&�`4����:�'qӆ�~oa�r��ƣ�����`z�t^�hp��w��������ڷ >�,^�ߩ� ��f���@*�ۛ�n�u �i��mۤ ѻ���cj��siqm,��4z��{ct��l_>�=�w~���/�b.9��)���e� �ƿm���h����pp�-v�o���a�q�p��e��wd���m�p7u����w [���į>rqgr��� ; �1u���� ����7��}5y�� ���~�lj��;%m��e�$z�� ]hh�!�7� ����iw��t��1��5s����1�򡖻zſ.��;�-�d�q��}���(�{i[ s�9m���y���z��n����!�qtkg�l�7��\�y��0n��ͼ�j�/dpk�7�������պۑ é �x��fes��ra�si8��^�m��&aqd`��˪&/��� ��2j�y]s]��ƅ��j*��u�:xt�����l�kb�.��w�5�u��w�kvʼ}�_4�� z��d��qv �=~���je�h�(�c���i�n}�}cw���o0�a�h�n�\m=d1�@�ؔ�s�����h=� p���u������� {��_�������|i(��l�@���{�/.�eѷmy��0��9-������� �r��=i$g��l��;����eb�o!6���c�s����g�aw�{e�ϭ_z\d��w��h=z��!�6'�fw&���_cc��dp��3b�ll�|\�ռ��x=ɾz�y���^�8�igm�(� �v���b���юp�������7'>rv9�2�ø�b� � ;�m���]�l�yo������ �5��dp��t]{̪� ��)x����w_�^� �ѱ�' 2�%;�l�s�3wÿݴpk�x����hxt�7���� <ܑ�j�"��ve���_��j�!����%z ve:�ec��,-�|:w9�&����lz��l b��3i����gv��t=��,�1gjօ � ����vtq�y��3�t�˖lc�p|�k%�#�?i�� 㝡u��~� gh��⺅��.��� �0 7tj'���eճk-&p;c�zn����di�,��3`4�[��h :�l�����>���x g� &b$��2�;�f��/�ҍ<նp�����@��œ(�r�,�4��f�'���ds.�y�em0s����m.�0 ��/��`�2��s�y�g��c{�`��&kg��g^,�p�s��y��7�8&���t��s?q���"(3��8�ė����ζ�|���"raa1�wh�� og���ou ��ec[��^��vs�q���d�9� ��w5f�*ijy��!`��� ͒� ��\�x��u�/�-ۗd�d�)�� .wi�:���"�7� rq/\��߶���;�߸u��~0�uە�n��#6v�q3�_�ꃗj�e�bdw�py��;���|o�3��>�꬀�n0^�/�q��b�x�e� �qm�)���:j�i��x���l�?��d��͜� b��d��c֘m� 5wxh͑vx4m �9���)k����8x�]^�\_�7?�`d����� �ё=^d��o���mȱ�&�%cxo�_� �� �'������ݠ�:�1f�x����ke ��gv�#���'f�v� ���# /��ot� �"=qt�@a9n/9��\nd��:�y�~��ɝ�!��,n��'k�f���h@�m��{ ])�#��% ��l����v��4��� �x�anb��h�.ogj��ʼfe�z]a* ?[��˃�f3��30�j8%3�̟���&'�#{�w�&��p��,�ͅ�%���i޿�v���l���o��?qj���# r_oig���7�r5�y�1~1p4́�`հ�j? �| �8{����w�z�㣰�*����r�'g聂�%�8�"�wyޔ |�b�)kw�rq�_�g��� c0~v�wzu;i 8�fun\gh�½bc�0\a~�o�f���<���}�v;q��bg���� �^z�w������&#��6��z�u|mi $n�b�m�lk w��0�zg�79��3�� v��񩚃�_�lhuy��l�q7 ��a�����`�9hz��=kg=0rdb��� ��#�uycgdek�� ��81 �h���\��hg�9�pj6��l�>�h�it-��`u�$�8����_��d�gq�ˆ� ��q���(���e�����t��g�de2 �}��,� gh�`�f��mpks6��4��� �k[�98�atu��kڮ���nk�f������ lc�o�l�b7�mq/@�?!!'���`��ov֎� ��⼐=f�a2q�f�>y�g�r-۠۬ ���* �6<�~��=;ύ�<����.t��jw:��e�t�嫮����>4����g���.1d��*�h��q�ep���y.�|�k�bņ=��c �5xb5��4� �uym!��n������:��2ksq��u�o=l�1��0ot����=�e�����o���4� z���(���\��qkhqg�}gȕ�>���ڐ��pam��������#�n�ed4%�~�3��dg�rn�eb��d ���8(�{c �d���p�rc ��m� =ξ|���|p��@�`z�/�^��d���oo�y$�/�5p��xw|�1���k͙�z�p���l�_�w��t5����b��ac��h#t��5��;]c�d�pvh44 �,��n\]�j�0gr��{��{<ǝc�@����)��'d)~���Šp�!�4f�~���n~n�m!�<�dp���s��>�w��٣��g8����.�{��km�u� jf�7��������7�j�g�]4�w;��ԙ.� z��k�������w� n}�����ώh�u~�c�٩�ݢz�3�g�ʹ�������:���m�mt��vi��y����>�ۼ�hb ���ή���ِ�,��4b��k¶�������qw���o�k&��#a^? o���5��["3g*�its:!�kӧ��9i�yhi&�[�߻�x`�xfu�계�8��p w"3��i�׽�����&�˥/�i�f��f�¦���،��,j� �d�͛v_�~��8�{����s#o��o�mw؄=�:s� \��$��b�;��a ���;���'�<�?r)�m�w/.� ��">d;�6��i��\�^�[v�@v}�m��o�s^.= !�<�j)��崃��`�k���z<�;���� i�[ަz��� ^ ~�8�bk�b�%�pn"�� _�!bu�f�n�ϊ7ad�$p �i��k/�b�ª�{���y��ջ`�j�(�� ͙�u�la�977��� 4!��ޟ'y�2�t�!���*/\$[����\���z5fq��[�5���x�v�[����si���3�ۂ����1��� e�#�i„��"ҝ��n�Ც`��%����ȇ���k��i:����gw���g?r �0s�-pc%�?:d.$��ce�mn�y2�zl5���b�y��h$�jj�_�k��>fw�8�mp��c����y��`���tj개������l&�ݑs�� ���*�#����k�fa-mt�ʨ�s�}8j� �-���dνq�a�mtk$�y�_��c��)�a@i?h��s�f�� tΰ6^� ��|�=�y4�t�z�;� if]��\��q�cf!��cp�&�5��[ĉ��g�д\ÿ.o�ɉ���/�w8v������� n\ݚ��s�?����cc�&�t2��u�.�o��/j,��%})�=��4�����b#� �@!�7�g���['5�|���4�ޑ��:��ǭ�e�í8�d"b��$v!d4� m,~g8�uh��xs�q�� ����p��v}9r�� �%���`ڱ�]�v���n��m����"�g1~jt(~�xr� |z��*_�� �=֨��x�� �ks�]���a��ot)ռb����c��գ��j�q�y�� �/��}�h] ɉs�]�`���f~a�i�q�, �vb�[�{8�r�m7ˣmv�kw��n�ٔž�ć���x,膐��\�.�rަ �v/��" iw��h�.�a{ q��avsp-q��1���d�nփ��6�k�� ���ƫc�3��jv��kx>�t��->�d� �#)ⱦ��u�e�e����"�va����c���7�%�jt��܉ q���'uoka���ƨv�� �g=����ϋ���^4���bp$�p�d��ar3�s�bp0n�'ܴ��>�}���sh0�ϻ�����xp q����u,���������o�y��r���z 5���0|s輣}8��a�u�a�k�x�w=i�� ӆ���ҧ�j�8/���� ?��l���6���n@�8�p(�������h ��ft�5� �56�옣��ty&w�� ���nc�zdu�z\�ɏp}_b� �r@1�}� bg�6�5�!o��ծ'�en�@�)*0.b�p`@є#8m.c?lb�ҙ�o��`�x���s���upg=sr�^*e�c!�,jo�p�y��c�>�pz���ѧ��ܷ6s�$.��m�dg��io�����=rboh� �5�s�w3umx� �*7��x������:��x ��8�se��r�j��쥾y���z�p&dt���8t��l�9�鉶��l#tz�9f��q�,�� k| �: ��д�#��*�;�q4dîmjz�x��~qb���>��te���� �a�f��@����)/ ��l�p h�>@�y5�����g�gě��ws<� e���v;�:u����������ώ�v7ό��h]��\k}n��j�����7]e-�ݫ&e��y^�<��[��ak�q8�v� �#5�#3�.fln�;j�e)�j���΂�e��h] b,�j���y�[��$n���:%r��m�-�wq�o�u�! �b;.a�rz\�\䧆n�?�n99d��h%w�7��a�^����\���o"�;m �r"���)�^�)��ϩ�����;�q�ze���"�&\q �g>2d����s����o ފx;z�t�m��c���ɼ�`�m���ҳ ���qw��px'�] z�����6.u���pp�-v��.v����t }m���dv�����x�w[�=���_�x'�k��u����-�2���ŭuq��vx� �g\t�#��҃���k���y���1�rq��'nяd���[����(uj �?�l \�ju.~��es��p���c�#����>u�k4w�dy�in%�nf���m�n&*�"�x�q>�of[�n�d�e[�[ 5�o!��j�-n������a�)v�,�8�_(���mωf6�_��!e�l=�w����}�x#��?��_�w�z�>�1w���d���3u����t(;>����0&ug 1��b̷�tp}[����n� ���mcluw���z2��)4#��p��p����m�h!,��֌�%z�h�p��`���>p�o :*ć�@ű#4�z��ϊ�>w�h=(ҫ��8�b2�>8 �#�|~�v�ixm��u�t1bn���x#��-���eǝ�1b}�?'zlz��d�׋<���w6s�&� b�: l�lv���$i�wʒʼn|��۶y\~yֽ���j�g ��`0�����d�g8����.qdb�xw� l�)[�x`c��9��8�_mj%���y�-h��<n���o�6��np j`�����ghv�rdd�u{�ۑ�s���ǧ^ȁ�*�m����y\��3�)�x(p�.:�¶� 5�@֔���ʫ�y�l s�-ex�a�u��q�q�h�;`�5i��y��w\l�5�`y i�ʃ���c��]"���y�d�����q�^m ��r_�d'���ךk�efz�@x�w tf�����}e�*bd-o*�a�gj�e�f^��� ~�mpg6�\|���'@/o�qf1��my4��?r��75b���۱wf�g.>��l��u�m�n����x2 ۖk�u.w|*��#�'r,>}�y0 !���a�, {0>��c?�������c��?�d�v������k4�]íf���ߓc�hn� ش5��"/s>��o��[p�f&$x�e��_�e��{�ۀѽh6ނ�&��)s���u]��@/bm׾ ����yb���l�g���n�ikly-m:�����`���{~v�'�.����ׇ��ѱ_�ڍ4\e� ��z?�wʃ�t��w �`k���z�����{�}h%6����s�6��a_����v�mݺֺ�5���g����5g�2nd�/(%���f 3q^t�de#�f͞q�h�՚x3ʝ4r�ӱ�%����:����mdj8 fp �*k s���8�`��7݆;s5��j>t�6@��n�������gpl��u����od4���c5���i�=���pmwma믎�{�z���'����x�s�:�kq���s-n; ����:�v@�r�"l���b�p��i>lc��%��iy`��� }`bu �yy�(v�n/����?���� ��s��_[?� 2^����!����������mu^�� ������u�j�ރd�-��f�����t�@?���",d<�#y�9t>s��|1r�#䱅��t]��>��㹀�ρgh|��e\4���"@�@���y�#ع���z�dd�!��j���&���7�c^w��z�l6s v����wc��=�"[��<��%�g���mc]n��)��r�8��1�����䣕�d�#j�4�ax_/g�r(�_�v��yx4ğ��i���jwe�zh�/�����������t�e�m�[z ��k��d�]&��cc���zwn�(p@����� �&� �����:�y�(țc��p)^����(-l���_���}q��˘�n\�ƥ�k&��"��� �բ� k�ш�s�'*�`/p(�r�v�b�"���&�ӣ:h��t�zt�j� c��c� %b����i[�x��0l0 ̛箓�)s@�z&���d��6���e�����d�ߔd��������?���������xx�&�ٷߦ��ׁ]��kv��ߏ=���|������7�ņb��s" ��v=p�nc�]|�ɀ��)����.ɚ�imdďԉ4���:/�����m� �������w@�hb� 7;��h:<��q���:�閹�,h5��ùe��nl9�i�.<�ۥ/�wkћ{h;���r�ߚ��j��g@b/���t;uk�3�w��� dt�a<|]n��8�bg��n̫=>�o�1��e��ٚ0� �����%�ɩ�~��$zݼۂ�өp�?�y�2��.�0��c�����{mw?�oܚ�g$l�g���֓s��p(����g�'<��@�1��(_�������$t�dv��e�jv�wǚ�ma|>b��ɉg���c?��v@�����y�wl�@�ǐ����9���x�|�������5�[�p,�i��e�i�s�=�v��hi01u{s�b��:i��37���z}֍�*��|l�_� �[��p��j���5����kz,x�ŝdp���,x��gfn��y2k�j *���:�l����,��d`p����z������u�,_��wp1��vx�'�y�(��ӛ�ã@��r�\2<���t�w�ex�kk��^x�3ԍ@����_c���'��<$��_��l��4̪}@v,b̠���=0c&��� 8�����:�/�&�����lds�g���y _|%����ǒj8�hb��r$fs������my�g�d,��yy����>�*ޣ r�� ��u�]]^c��q�ܯ����:����d�s_d�}ؓi2k��.^.�(vzk�m��v��mm��7s�7�=��0��~dc�be�s��9{�����fi�7ʢ��mgo����p����.n��û�%ju3����,�/>��/�^p�.���􉝓c������6�v����&7�>�sb�>�kȯ�&�o�fm`n��լ���� x���g�u�g�m�m6�j��vو ���f���y{r���j�g�d��bj»�h�}hg�j�j�'���v��j�1��<,��z fmv-���ԣd�� ��q��;gx_&��:�f��f�]q�$�̻cvv�ukf�seʌ�}��c��i;x1_j�cga%��brhʭ[ �h~����[� b1�#����|ߖ7��e�n��h������@ �mٶ,���� ��vk�7�_��c�x�35xe���& ��g�:�l�<�h(�) � �ecc��汷z�[l�)^�š���r�/τ���iet��b���j�e���?�����9ꤾ9�i�,֟���������ga��d#��|���j�ov������f��б�f띝:&gw�tcf; ���2vj��>6ʀ���f�c|��>���`_rt�?�9d�� ���.��u�e�=�� ���˪�揎��y�%���sb6��ǐ8-��n =~�5 p5`adik_���){��=�1j^��^��[�2/�zd� >��i^�b��*�����o,�����@ �j�c/:{�:j��-�ƿ�r�yw�j���m�tu����1{�����ü�<�8l�q���)�8탯������r]�x%�j/�v������1��v�!,� ��.^�_�`�n��o�άp �*�-�ns��e���:����%>cĉyu��f��x,t�{�js��i�<��o*�l�>���dh�}hy�����x@�)���ea w���t xam���ăr�)��ु��p���^!cm)1do�g �����c,���~?��� .c�ܸ�8��k'cd ����k ��,����#@���?�t(o�� w�������1�g�mc��ҟ�7x� q�(� � >��b30p� `�yp0-��#�qize ��j�`7x�v �y5dg����y�]t��v��8d �z.���k�,4�l~ _��=��7�-��;`�<4>~q.��b^k�a��mcӧb)��`���au��cqmq�'-���m{� s��z�a4�x�ؼu �o�z���`����[���wpc��3݇�bߌ.��3�g0���z�*o�4�d1f2m�@��;w0<�g^z�en���r!�~�9w^ .�h� 5x���o.h5*�z�.��ac�w�e�g<0.��ք�g^ ��=��_s�����p��k��q�9�#�:��s�z$�#~a�p�a؎#9��ܗi< �ok��*�xm��e��ֻx�iz!�.j\}2a��v>)6����%��ƌ�u��ȷ���w���.^�_'��k4�߹����������me$|� ��j�=9���t��n<2!z@�� %�a;ee<��t��-����r 𥎏���k�s��q'}��f>���e�yiٷ��8bo��vх��t�~cۆt �6� ���؁o��n��n��=�l�� �t���� � w��s�^����p4ؐ�a^�x-b������cd(> bz��e,bex��=���f���\d�i��ц�md���� � � �l�-�l��n��nd�� ��[�[f�w@�魪⏄���n.&���f=��:��<=)�s�/ߠ��ee�kz��h�ttd��1q~(�lfp���ޭ������p�q42���k)'3��"�= ��!����|����e�[�.ih�`��a�im�^z{�i�\��1�^v�a�b�8gtn�c�5s�6ѵ���1�cl��%� gi��:�\ck`���wџ�6b���=�=�ȗ�?b�k���@i�y�����|p���g݆ ����u���㜩�njm�u�� ��p�� �ea�miv1�¬.ם��f��܃���/�qa��s��g ��a��%v�š�ǘe�>g&�'��n����7�rf����s��)s"�� m��sᩯs�ÿrt�x0����gv��e��ö�ܼ�k����)�nac�m���c�{tk����} �y\c��v�x^��,~���,6����pk� �0�6����f�c��2��1�"o�ަ�qr�m�1()wyq�-\�3{��?b��3�'{t�����vz�|��=�=�dzn^ٺ.̆bz�w���:��-b,~'~�a�j�-�ԍ l�&��do�{� p)4ht_zy6�6p?u�o����(j����gۃ�sk�o�p�d���:(����g�ul�~�������ީ���w���������5�7���p'�ɵ��<7w��l/h�����2_"w��c%�xe������z��ow�ah�.!-����� ��vߝi@�����ðm�ft�|и'v��h�����z�f���-ٯ n�#�:�i�ei���%ۙ").� i����^%�y�'1�)��3�r��r�g�ui�qz`��@����m2�ޏ����n�roн|�߻��؏�8������40(������8�y�2n޺o���^�߳g����mdx���}�ƈ=q�b�i�_��љ��t�h�ag���԰�<��x ��0b�zl��bci�k�b����5��v1��{������<��c9��)pl&o4t�ҏ����ec`�l��nx�&� 1����������j���v.m�>�`i�an>'�z�����: n83{m/�����r�� �.i�n�ը�k�5��� 6����/��k�a$�0cy:f��<�łx0i� )���2��i$�0�}o�� ҳ�9} �%��יִ"�q[���_�:<=7�ߋ�j����]�i .��b٥��l�q"�|�!!��l���}blt�#a��t���� �h$�(�|�m��w���j;�:�u|�p���b ����.�����`��^�x gh�jp_o�]�,��e���э�6u� v�������u�e]j��o��g$��dt�w@_^�c���q��>� ~!��. έ_<��6,ߘ�}�]=��ɏ�a� -���3$pd��2��7� ��������:���0���;##���h�wt����*�v��]�}`��[� n�]ԃ�\g��m��uv�et@�3둢�ư;ܐ@�?�gl�d�ۆ�e|��j������ �ip�����fmt�ؗ�-�#��<|���2ap�a�ص�j9nq�g�� t��9tx��h��te��z��ig��“ �߈y�{�x6t fvao~.l14�,�d��ѻ o>�����*�l��$䥼�d����������߽]�](�a-۰}���� =��â��#_�h��y�׵���l�����7#��6rt�ϛ���@��o㡅!�)�2�l9��u6�s._q�j��r;e`�d�ntp��)6���l��"ȥg#|'�����no��#�p:� m�p&om ��f�}:2'���,χ�y��c�l�( �wz&�\�i�! ���f�,s������g60u?�:c�v�(hڸ)�wl��]�b4��y��e�� ���wo�ӑ6!���ts�y "'a�` �=0m]zbu�l���>�h(�� ��!`q]��6e]s�&�v��j��o#�\io����kw�c�}'�s�����d���rh�1�t��0is����u�?���$s~pm���esփ*�����bl���t�v!��s���_��q���du�����?�| �����5p6%� �)��줮g���^���5,�?����au���v$\� �-����g\ob����/ge(l}�'{ko*�t�#�>y���q��o�� ���åxf&��ł��c� ����2 �`a��1����6���h��n�t_[f��ɉq��ߪq��-�1n�ó�t)j�����xɼp.�)'���n�l�zlj:��ץ ԍ�,�`sfb��ր ���b�xmsj�;f ����z�澀n2���h�#�0y�seoو��sp�����)j#o*i{�y�t�u��.i��h#��{k��k��)����9���a���"�s���{~�w�]��6��xwp�}�fش�"�n~��a!;ao������[}\|�p�v�xr�22�@8ɽ�>�� ���#���m�j��xpia��7��“4j t*����e�>�aj���$l�רj�rms����/�sɮj�յ��{������ͦ�~���f}%��� )�'�*�qxr}���� �����cc����&lx����������_ԡo��}�$#��`�n�}c�@�s�=�'�u��ѣ�� ���a"_�g6���b0��9����=mi��c�a��xs=s��?� {"�a�$����f���z�x5e���/��b��u��v��ü�׾defmn���� _���_q�/ ����v���������w�<�x�tdwg� ��y��ѩ4�1�� �z���2���a ���9 �l�_������ ��_�'��-r/s#��..�] ��,�o;ms�pnx��3��q֎���s�uw���5g*5y� (�dj�zm�!�2�?�đ^���(;%�����˿� ��mh�)�y�f~��ۜ빻ĥ&꒠ǒ9)�в�v���rtb�p��bg��a��]q�]�g>����ɝe*�v��g�[iu��� �- h����n�ҁ ���l���(~�(|�� � cz��8=��*l�����nx��4�pj��������f?�� 6�xj0��{��x�=&�o��dҭ�^gr������nl��8�����[��s��oq��u/�g���#��ol\�nw���e[2��;}#a�1�&��,{���0�w5��l�p��3��k�!��)j��?�f����<^>�*��|�z��ጡ�d.�pȅ)�6�ڱ%t�2�v;�{8��9�� ��5|$781�v�efc�_ep]�``��{��a"� {%qy9u���>�=�ң_0z�,lv���[o�>��(`_f�ím����vt���z%�읺 )�ًo(�� _�5��c�~���ߒp�d�v4����~fh�s���"g��4�]8:��u���moi�{ �kk9��՞-�]/�#f.3�;������k�����plnm�h� �.t��l�)��⫉���֔4�v��'?r��n� �b��^�u ]�]��%���� �<|b$k!�rxq�gw�)�9�q��bl!ݴ�8 �*�_i�v�ë�7�0��gه��7���.���x�$`�y�.j�؋m��km3��t��ώu�e��g����w���f(ʁ��ք��%�? �k���(b0�c��;i� h�-��w�ՠ��l��r��e�y…(`%'�ӳ��d y�mt�nӳ��c�t�uj�=и�� �e٬�ugtde|_-�ek�0�����kun;����9�)k���1���lwݾ؍u�h2�n_&g�wľ�;������!v���"���#�u�&q�њȳ:��^�j�ur2�����a d�![��p�g�-�p� �s�|4�xe���d�an]z�������k��' !�e�#c�' -䀏�"�.y��y��>�ip/9ri&��� ����*m�=�j������(��l�γv��`�oz�:p��ow2g�zx�gi��%� ԕǀ��l�t �m�d66�����ȭ^kvz ��b�р�h���i�������ce}qp9ܒ,`�ś�/�n���5lx� ��s� 1��u�s=xlatooyg����2v�p����.�?��d�x��iiy� �yl��m�� w�j�7ଛ�l0$z0���(�>v�n�m��1�z]q6w���9��mi8����%"p�jbu�}#���ov6*to˥۾��w�<�z7^�"�����z�(�;� $��"�c�a�`�/�o/�����'o�h�dohoa��}�&���f��ż�l;�����q$�n>�4�#gxkj���ohc%�d]-�c�oяq$ny5�r v鈰6�����ah�rj�bl� ��~�gl�𙍮y��ň6�����3�u�9�ߚ֦&��#�4l!袖}�p����u��:i�t��sn]�sh#��"_:�n��{������y�tьq��<8���c�} ̯�����c`֪9���]��'� �jy���‹���f�#: 8a)�p���ňma�<�=�/�q�����r���ke�w!2o �xtc�h/k�����bw�g�,�t������0{�/�l�@� p/�u��b���~ _�tع�k� �\z�h;n���u�����{�'�gb(ƴ仿`,��m�ݯ� �gln�fπf�(u?za��ac w2#��?�^���& t k��őx�8�^��fp�`�l��ޠ��x���z���ba�ȹ��o ��� wm�#���lj�jۚ�j~�4�g?v���ck�r���7���7���_d��#��͹h���#�~5�im y�#��*��ؗ����}�w�����&����p �9��nrud:�� ��)s��í-1�fs�ah{v��r�����=�fl���r 7m�bsl�/�7�d�ц.ҹ���մf���*�����"�� "��vz6{����c�� ���2꺽��h�e�w��^�c�w�nw��ϱ��ur�?����'g �t"� �m�v1�;§��}�yޣ�"�a�ny;5�{.�t�]�_���ゾm�6<�j��:�a o�`f��zf�m � �����\ť*��[챞p x��ůk’��y��e봜�$�e4#�|ݺڛ���s����{_�ě�#ϥ��k�� ��ާt��czfsv�oq4�5>�l��rh��pt31*a<�@��cn�5�5����� ����3��rk ��.|u�؛su���s��&� h?����*�r�hi\d�o�xs�j6� ����� p�� �givdǂy��4���1�t�`6���_4)�9�����i�r������h�3�q��!����b��5{ �[��e������tt������'ށi�e�b�kх��:�h�b�g��k���v ��zgzjfn �����[b���tؠ��n_�{����=e�vԣb��an�7�\~��a����s�v�95�q� �zo =�^����g =�o����nu��⫝�b9o?�j����v�4�k��v�5�zwg�եmo��������hl��kz4 f��c�m3.>*nu�j����&j�2nn��ո����u,�w��q���oa��m,t��r�x��ׇ}���!x�bqy=�� ���j v���s��� r���qm2;��e���{1�h���h�����}�b���@�rc�14nqz #z�ja�mc�pive��q����l_b�w�@��;��n�tk 21�lfغ!����p��x���!c~��5 $uc��ܙe*<ǝj ��$�]nt�]��a�1o�opsiβ�k���j6�h;t�e�v$��27�6��3a�inj�6�w�xl�˱x,��ӷ���l��$�#ޭn)��.l���^��4��o�e1[bɟ� �k ��i�����(y�����5=f�y�a�٥��ޥ��ruky�<�x���k�b��dbc� hv�� ��˒��>��q,�"��x�f��p7g��̇i��ma,1��a�|�v���ꉒ�6f�mq�-e���7���u!� m=w9��֔� ����-����n7 fys��y�xk<ǩ[��\�mn��� �yլ��c�����w6՞ߤx他�}l�zdze=�����|o��͌��ϙ�;���ܬf,y�>9~4`���ha���'|$��ps�=yrpy�y�`����i�t��2����u�r�־q�p���/�}�v��dzx�p0�:a���{���bo�r=���0e�a�t��;��fs�k>���31p.���w���㌊d����j�>"ʩ��* 3�����y�9�k#� 0�a�f�b��,�!�b��sp���c�r3��3�h�l�[�2�y�k�������̓'�$�s�(y� ����m�[���hn�#�����zr ^���l� ��"�d�>i;졇i� �ڱ����> }p�ُ���ec��6���ri�#�bvp��a�b�r��be���nq�2�`ߐj �҃xl~5��w�v/9ň�׸2�������%���.�~p��������-�x~v����mizrm�l���i�� tk��fd�/�mr���.���ε��3nj��t�;�l���5%�rkgy�(]�ȇi�4s$���vuu����l@a���>d���a�҉�m�9��y`�u(m<l��a��1cl]���t9�e�;id����nf%��d�d؈b[v�1ù�- v���|h[ )��7ܗro����k�& r7��=�׏�>�۱�8�᠗��m^_�����'�=�csf��ha9j����0���zdc�h"�f�@ǭ�*q�ݎ�y5bju{b�����f������t���οr�%s�8;t}��̧{�g���s����7v�-�°e2q*�o��fv}�>����g��6geo�������k&os�h0�_@ñ�������e����7����^rd���prνri�d�}^�j9�`��d�nn= �{�o���'�g��/� ԇ(@�t�>�r���w�v����ttc�<>݈{ŗ�{�fo��\���)�� �3sᣨ�ty��5›� �1nu����ӗ���azf��v3�����d��d��i�x�=z|�w*%i��!a�6���o�e ^3�ȇ x7�!k�� #y�j6�:�5�~� �t��0g�͉7$l�u@�ӊ������jv�r�<�'�aw��)���[]��лj���f욏��z<�k�dr���l4oas5�f��;e�1���(@~ � %���0zƙ�~�n����8{֏�(>��!:^��c;=�m1_��gd�~��c���ϣ�� �o�2�q|�q�mh�\��%ya%�r�-o��r����jpx�k'1���c����3u��b ��,�c��ۇ��&�}j&��ʅc�j��k�q@h�p(�f?p�|{|_��]�l���itݦh �hб��#s&���o zu��z���$p�s�mf��}�����yd�h�6z�� y�n�f>[7c������ʦ8hp]e�ʈ�i��g�mʁ�n�� ������,��uul�v�%�-&�����u�6׃�����aw���=�m��6����s7�(< �s�~�%���@�iz�� q0լ��gf��z���?a�c���y��ɓo���g��gi�lj��g��e�b'�iz�}������m���fu��?揿i=�b�����/�p�#m����o��{3�rm&s�?�m �x�мgݽlv(��w��a�|�wjنft��|�:�s�{����i�p"tژ �7� zp�a� j2�*w߱����襅�ga� <%��,�uv�kt���8t� h�k�ĺ*�u>��t�v�eƅ>0�4�� 5��p��n�j7�e^���!ƶ(h͘�u�h}�qtruˌ[���(����\���&*�y���r7m���xo q�'3�% i�k�)�l$��l_����e�9>�)��� �j�����b�f������z��u�� [ӊu��|��l�d�и�mb8�h7� �mw�̈́'��]� s!��q>p����܄�k�go ��&0����cbl؄ly|�����4⥊ �u��x�q� f��b� ��sx[��a��fx�����"��y��;��(�[�<~���u�|%�����5�28��v���sp�w�1�f���s@�ˈ�[��$��`��m n�2���r�c�1&j�.qćk��y���ϛո���ӕ7�ڷ��߉ucу�^]p �ro�p�a��v�\l��7ν^���,pi$f��}�/հy"�8} �[{���/��"y��z��x�w�����h�i"1dws��wx��}{���!0����t�����4"��ħz�o����]��^ ��ѡj�a��p ���ؓ�/y�džp���;��c���t���٬ɓ�0s`�sy�m{ca����*�"�*�^�.���������%�j���bu�es� %���g޻6ǎ$ ��ˬ���xm�qy�����{y}��%�ͤj�3��� $�q&��@�b���� d�� @�5ckv5�"�������?f��k��;�xyb=�9�0�t�g6�~�^/!k�ih��1�,\߯���ξry�:8�r�zl��<� �d��s3r~�5_��j�������ı��q a� �udb��a�8�q� r�c�.�1���4(��ϧ7�zj@���.\� $uܬ�g�k�te��g(����u��)� �u�n�7�n�v%��x�&\.��k���$�u���ܝ����2��}��!eԝp�[ l���w;���-�o�zv�� ���"y%�� �" yː�rh����:�!��y� ��z5i������ֆ��k"�scn���402� ���:��@���lx�]�;�d�y��kxb��t��f m�cpdh���*!����� -e�[��)5]9�!��(y�ý5��ߙ��d�;b��3 ��f�����v��"�.�8���z��i��z|b5�x�w��4{�s��{�����p��fj�e��!)��agke� �#{z��q�>:[�=��/�(7<�ǫbk:���.���֓| �a� jj����1�c@_m m̢f�y��d��9���w���b-����@��%�>q��euh�!_!籸�ᴑo:j�]�ɓ�e��2�t� ��<@�ab�m���� ��39��$fr�c ʑ��gaz �o�� ���a8?jrk��}�o��rjiōe�fs$��v��hd��@g��u]6�9�r�"y�j\7-0��n| ���1��4aw�o7�����])��p��ixefq���m�ekֹ�h��6@����c�;h��v�]j���}�{=�����(�j�:� ))v;p���cj�ߎ�����`7����(l�ª�u�r�� �!�c z5�n2�%�����uky��r$z�������v3et��@��a�f]�& -ax�[$��{%{�r��m��&�x��4��s��r�#�$x����#-n� ��ӝ�=:ש�?�ft� ��<��۸0;s&e��6�b�v��f����tg��)*v���|��5��p�m���:�!�k�3���i_>o�g�#ղ� ��z���a�d�����v#�ah[x��$f}�� ��� ����� �!}���ftu����!�ck�)� 'h_���_3|b,���'�)tws�]�����p������]��q@𫲻�:�z}��n��_��-�|��|r��y�������9���[l-���ca�&�~��<����h[�= ~=cq�ױen�k���@zmbe�p݂2��rj8�9$�� 4���g†!�麌7j��`s�.�c�=n�'�t� �p�� !�i�1��$���(���!�͘�s;��"3�{�ý�i���7�ƹ�l�"��m,��k�� އ�ԡ"���#����^]�<�0 l�b������o����s�o������ǥr�҂/!���a���ь�$�0�ml�@w#����1��`vsem׺z�j6=��h�}�k`m2�<��3|k��m�d�������5��֤�g�@=�emh�n ���ć�s�f�yvw��(�[t��樭�i���d��_x�8j� d$h��k #؀žc7�0)�ϥ�!"� c���#][%�#�_�rp���d�ן?{�n��r��������(/�u��-���v�&�4����bfiړ���䴅ii���k�)q���8��ʥ�tkvӿ�x���t��m��87���)����ja��e�ٚ`�ӫ��٬δ/��\�:�-s>"����b� %q��jo6�$�b m�֛�v����� �n�p ��i���_���hd�bj4��i�c���ud#l$vht�ֺ�dt$�����9�諎�� pl=��8ۄհ�c�sf�i���7���5&1)sdmc�7x��� ix{���bj��"i�/�d�]*i �8����s��!t�>w|*㌨�ã?��te)�xt��٩n�`���9�(� ؗ�qch���i1ݾ��� |>}[��w8�w�~1�l�.�x[�g7u[co�!͜>�q��h��)�t��|�����lt*��џ����2�z%z6d��x�.�������s�@3�q��|� �뷡��#��9�8 �o�٨sxv���%\�� �ŋx�`���tڛmw4wu@ 2(c���t�ˠi�a� 8 �1��z|�[�n��f=�?�l_�n���`b�64x]u�v��(c���'���>����$!%n��jo$�;5��e;uem"��@�#�l����ds����o#py� �#��ho�toy6���� �y����#؜a���=f�˪.(w͉s�� lhzf�v���ݠe�>�wbsxt5%����ge��#^�fdj�]]�μ|� ��'c�e�t�f�b@�tn�� ��dx`o }���2�jn�'��4����k�/x�)�#��cɖ��d����bzf�s�u�330�ac.��>��>2��ğ�1b�= ��1䰁��k�lv��|b�6 ���h/«���^��1�xȴ��x��'j���r�lד�`$���z�s[�� �]�.��g�ij��w�]���s��z id�d:|hzs��<:a���ȿ�k�lovؐs �zj"a��r�g�}_a:�����������>]�փz����'&��h .��1��$& g��"�kb��fl�wp@d ct\��e"m ]��i�fd�jt�*���_�ip��(��2�� �ɓ��|�� jte�d�=ܭ;���q���� ȱ[g|�&�8�����m!����=�d�#s���m�*�����%��t��=�^ɾ�^*a{��"m��ͽqtdq8�ac��z��kv6�k��ybе1�u���m��$y�˰�j �z��i�:���@*9"[���5��g��ڛ^(&#jd�ݍ���-k��`�<�rؑ�r�����]g��:���؄���r����1�� z� �df�%dq�vzqv�#��4�{�s��o�x���u;�zv�{4��c�l�bpu��o�!u,e䬫9��\淘z��ܲ/)��h��&�ҽ_��3��~�|����l���yc�k�� ��]j=d�� �u '�?dt0 �����u�fmի�~�5�n���;'�:cm�qз�.s/36x6j����!��|�f�� l�!���v_ 2���hm8� =�w֌�j���֗փ�ۏϟ=ӳu�k�)sl��]�x菩=�g;=?m���j'g����c��w�#bע�v����@5�t���)�$��@(���3�*���b;٦ �l���]�&����2���{�0ģx/f� �^�j ��x�^��o�u1��z�x�l��o�ud[cc�q �mv�.�z��� wg���-���"o��#�?�dah�u��":e�n�f��ڵ�o�}�_��e���j�.�#�c=֏=sjlh���8�}��g��5^y��d�o���up��t�ۉŏv�…��7��mwۮsl�wv e��n���ix����ٹ�%�p)h yp�s$>%�9�#���z�j"c����il��3�np�h5���}f�(ejf���ތd_r�ʥ���f���ӹ9��nl2�6 k�f��#j�k� x���_x^�ݸ�gh��f��b�],�oz� ���j����� ё�6��<��j_(��~z�������l�dk 5�i�$�� h���{��`],�2�b�h���y�;u\�����$c"���jyb���ɓ��_`�n��5 ;���rt�fykc�⇤�)�]�匾��~[3=k�o�s��j�*�:./����,{c�~ay��h q���b�i~v6�c�) 镁y�cg��)��[o!���xjptfu��5_'����n�¿�'����w<�/���b��y`ը�l�x��k�kte�ת�� �f#��n���h�k�@���g]�)�#,��k^�d�9��>̴�_����_ �*���0c@��r[��>��rk�@�h����y���z�@d�h��g2h_������fs,�u����@��@�ˇm�f�g�u���t� m��"�9�ʭs�a5d��% "��vj�×��-���Œ���sc����o"�:�c�d\gq� �\$ 0�)��ރd�^�c:�x0��8.� ~�!a �f��\�[�8 �qqpj����lm� �s,�����p-i�ewʴ�p����amp$^�;px��i̓���(����#_���\�a��&4]m�?p��&~�b��s!���ؘ�ki���&���x� ���>髦�ts�z�����cf[��zl!k�o�#�&�}b����c�i(�@n�4�sgme׌s�6��w1��6�o�g���$�<�]��#���~�xӡ�3p�ĕ@���έ�gq���^1�lw�x%����7xc�릞�c�k8��! �x�0`�y\�og�w���y��;�u��:�w��dy.���m �jz�����k ��1��� 7���5,$i�� j ��� ����v[����p?%�(�'��;��n��{�@�΍����[�� yqt0~��z[����#�5��j���^�꾢[(��j��wew��|����c� �j����0~}ibz�"��<��7�w��e>�zհ~zm��[�1{��/��1 1��t��i�tw�;�r�9!�� �tbz�:�m��m�������/�4� h0kӫ�ϝ�@�5��rgv�dqv�ڭ@w����'��$�c1�r ;f=��9���2������n����m=} 4g��h���u�\�՟���5��c���0�z��������@��ok�[m�3k}�`�! �8mrgb��1 �����a���]6щc�૳ivne/��@]p_c��h~�q\���vqt!���4 u�9����u��n ��]�f$��s��*n~�s���-��w�.�"^�� 9�ڌ^d'��$���.uq�[�|��z3k�^���@� ���c�(!d~� >b�q���x�5f��[5e�ly��.�ӆn;�;�o��g`l��nz��������s �ng�e��3jm��4�o�������6�b ���^7\'�n�|��p�o�g6�k@u�k#����ۭzm~'(d$7��l�m�z$%�"�.� ���alm��g���g��#h��`�u<�����qt t�ݔ�o"�qϯ�`�j��> "t��nt�/#��j�o}�ש� őx�p�k6� `��a�؈����� -�` #g!�9h�f�og�.���z֘��h�"�p���u[lَ���u���b}�f[c ){o_t��ֱi 1�1���5����i�����'q�h�a����2>1�9����w��zow�>չ>n?��mq��b)ӓ'9b�����j�al��� !���^n�^y�u��ŵg�@z�%�z���~-0s ���0�� �s��rl7q)�n��j�2�����#�7q�h��,�c�c#��x3��>( ��*��b�w�ji�py9=ڒ�7�i!�7��f�od�������r�n���g�$������(p�e� ���������a��0l<�2�\ee�û� � b�juo�rœ7�s0�2(e��]h����$z�qe���l/v@hq��k���dc��e=�9u�xűm%z-���l�td.�~d�*�]y�b?f�[��������12m޲�tvd��x���9�>�� j��������!ʋ�c�p~ q~�aٮ�k��1߱]�����a����k�v����v-x�����l�����ޠ�o����j�������l���� �>�������n�_�e�φ��i�(���r��x�_�6(��{�����ψq5c /c��e��r�g��1�-�h⴬��ce��tww�o�m?}:���, �\��f�e~�u�s�lt�г㿿.s�m��1��8 ����m�-o s���#�盦c�~��������ש�����d�85��~��`��[t[r�j��f��2��.��fc���_��`g@�a�{�d�=);���^1�6�/{1/j�⠚� ���r��π6�� �*�9ie����޾x��'>�q�u��p� ����!@�%���.m2�_u�kb�q1��s�����|bp4���b�f5��xp��)0*�� ȣpm�?���vyy�������̜�?��a"��!8)��| zí�ok���q�{dm��qс�މ�ƻ`��`㽨�k���׉�d�(�>��ڬ٫]���3�ν{-��'�j h|�]���f-��u���<��k�f՗;ᾱ�sd"n��a�>@���m��7�6��k�qr&on�z�u�xc�u���"�����s��h���7dg�缯�t�j��"f%���hyd%�����qijћ�84$bb������2���4wg�j ��z�bgҥ�����ţ�j���߳�����2s��p@m(���8�����]ڒ�(�m������c'm>:��a�)�d���� �y����c8g00���63�g�aq�� !ix$q�v/ �h�q�n��ȩj %����ͻns]m;܉�g���/?^��ύ޿ib�̯���� ������8��;�g��ӈ�����u����ū��]����c[e�c1�x~rt�jl�c��x����y�����h�m~��omrjlժ"5�h#�f����m�ъ�{f��h?)��ĭk��sx��߱�x�q������8$�)p�p��ƣⴤ��c�3��rf�a�l�q���c��伅=��nz�ήaw���a���j{�y- s���]�oe�v�aj�j5�0.q����d�.2}�)�r�,0�@j r����#�0���uz�c�����džn~�\ԣ��o��)�,��0��@���r���~���b:��yyaklմw��οoä����ޫ�����ΐ�|��el0.�|� l�bp����tm�0_2�zđ�o�gx!�[���u�r�i������&i��w�ފp�5x ѵ�˔�cikb�n8�fd�s��e q|f�k��fk�y���e*dۋl�ƛ>�;�i���s������|'d��:���>gm{]��y=_����fb յ���@���v�i1 �l���p�r3�����ƒګ��v���vfchdtct�>n�t���j� "?b��"�8ʈum�rh� ؽ(��a5���5/n�⥙���x�k��\;y�b��)�ƃ{xe"�t?�q�#�� ��ޔ˥�gש��)1��4o��;p ����p�ܖzr�]{�t\���o��le(����������_1�<� m�|�� -�dd ����0_d�up������v!_�d|f�)҉o�' �?�*r�rǿrs�q 0r��|d��8 ��e[jy#�� ��nj�";�똫3d��ȳj� �u��i��m�օ n`|����ؑd�;�eأ�bl \�*}��vf�t���벏� i=i��wgэ�s�y6̌����>^ ;��i5d~��w�ge�� 7v��a c6��>itz@($��tb�_vr�jo�}!�<�u�,8g�#��d�"��l�9����5�mm�d~�$��6=�����@ 9h&�y[�i�n�$ƀ�}�����09m$�x�k9'�ڡ�3� ��p�)w��oz�ߍ��$�^?mt��:k�^����d��y�x2�:wr�p� ؝�k$�έ�n�g�p�t� ŷ�n]jra\&�����vw)nk���u����)��bp�a&�:1vk��y#���d\�7b"f��cl c�, ��p��$��[d7t�j�ud����$�v�b��q�htҕm7�,q�/�fÿ��}��8�݀g$5b ��k�^��� $�e d{��fgn�!z���=p��� ��߼(q�j����sq�s8�φ��j��'2��n�tqd������^9�ʜ�!d��jl�5vf(�>��c�r_�6�pr�t�iրhg�{pn߿:��?�p�.v�g 5��9��h��d ����ms�tó�@e�r25�%�'�e�w�ǘ�jg�/a�a7:��% l�89t?\k�ۓ�(pc�nb{Ϳ��*v��wɿ��.o ��/���*� u��qm�}���5j�t,�`�m��h�zzr��}��n�o�?qi� �,� � ��`8s[ -˿������l���s �fyn�]��� �z�ec�l�p>؀m��-p��# �٤o`qi�0i��z���-`a�� �__��ވ�:3b�t����hm-� ���vf�ia�q!�l�y� (�@^����y����zs.j�m������1��i3�%:�=��ݥ#w�"�{ƣ�d��h�rغ�9��^|t�@f;�!��w�>�6� ���e�� v�0�w�k�������{��ڋ�x�^ǫ��|s�r�a@����l�fu�����gbe� �t���ը��~�~[��uw�7\2�}u�m^��j�7�lah[࿧z���o�n��kw�|]� /�s��`h�e�e�t�$��_ vw�����t=���&y�li�bp����h�0���>���k�g��1u�se�l��]g���:3�g'���eai��:�\_cz��2���xhuh����%ϻlbu!�o��pkqxp�e����[( �?t"r�i�=k8f� u��wh�3j|c�3v��;;g�ڳ���@x��ٓ�q�(#'�٨��=���q��"=����~~ޟ)�b� ��ih �~���j�xlk��9 3mw��ʀ�qf�)��5�,���n;�mk���hբ�$&��|#u4t���#wdсf��q��":���$��� y��d�����t��xj)��@�#ôp5�p&���&�h����s���i���3�i���ݜn����xs"pn��!�d@d 0��"n������b˳uˢ�ޒ��́#p����kq�%9^�p~ibd�ph���揚�ݦ���ӵ�u�3������z6e�_�.��k�h����֡^�h���d�vy!���ą̊́���9wrue�9w�cv�����y��c����"q��!~��lo:]~�^��z��u��q�&�4o���a��k�(�����4������å�;���e:l�-����#ah�u����"g�1���;uf6��tqi'�_ �8������d��<�n��v��c���|��n½��27��o�ǽ�:��i,l�q�s���g""��򔞾��i����38ԓ>0���rv��mr���ʕ�ci��z^6 ���n��x-�n'����$�p4�'�� ��7̩�o��)խ[r�c�/����j"s����8�mٛ�)d�l @�vf��� r��%��i��u���ttu\�«na���r.`��o.��р��.>m�$#m�ub �;���=9����g�"��6�m�kf [�%�x� xļ!�����hqڶͼ��a����\����5����au��>��.�.����7e2��!��>�����\txoe�7��c��\��� @��i���8`�zw���vۚ�:�������������ɞ=�k6ɞf�ٗ���ͨzmw)ta��� �1q2gmgg���4��)�z�_uw1���u ����/?fg���[0�5�β���nd���̬yʰ@��د�j�k�����\���s�p�c[�h��l��8j�3�w� �s??w޾�/��?�1qo�� ��tx���s��{u��.-��t�ɋ�>ğ� su�c��bz�v� (�5�8 �7e�'����)�:�0��5�:tk6k�u ���k��d�g~%*��ja���$�����p���m���g e�j7���lm|k��� `t����v�㘑be. bk��[e��~�j�#ִ����f��s�'ј��.�ĭ��>r��s4���|���j��4���[u�ݱ�_�ui�49��xa��d�f�t���'@�@��nm�� �}s�`z�������jy�af�憰��}���/�{w}5���v�z6}��42n�j֦b���������?{���j\&�� � #`j\༏ *xe#�g*>�����axg���v����cp™ )pu�-)ļ�.�/�v\��νtu{�.����y�����ń�#;f�sy�b���bb���|���r�!�pl�8��uki�l@��)x=�k"�p ��n���m�6~�h�v���q}���� �k��$��1ʀ��ip�����rg�ae�5i��qu>iacbw����e`)�����!`�4s\�)�� ��"r�!�!t߭˷u��\u��e�p^ltxl��կ}8��x�*�c��bgzn�tr�u�`�� أa��{��o@k?��z���^��t�t�a��bhmk�3`�x�����&jk� �&���5؝�g���n��r�cno1-����{ļ��:�� ���s�b�w1ٷ����b�� ��@�-0v&�μ(~}�ӥ (��dp�[x�ep]�0%�j�ŏ����׶��\^� �q��ހ?[��p3;c0��f���l<�r�@t�����^�dr������;�� �h�ӕ�ty���(��p� ��z�!����0�=�=�� �^m�������#��������*��r�;�x��^] ���ϧx�߫c��c���ja �n?f��b"�s��a�4�pw� qc?%u�;_w�o��[ �t��]c�7�5�¥r@�b�l�����* "dq�jr���ђ�ެt�a�uk ��kd �˒ïi�qt�nra�b]c.9o�"��,�*[�_y�c( !�e�-e둍a��멀;-\[c �i:0&�:�����pv�k%*ߖdrk~ffb7�s��$��vcol��h ��#cd1�e�ƀr�f� ��|2b�o��\[2�z�'�3ƥ� �=���]�~�)\�w��ai�� ��ypd ��u������p]av^�� ����*�q㧿<�������?� �$�q���?�ոwcւ�'�wp��m �o��[_~��b�'������j/ɱ� t�ͥ�@˰u�k�~'���'�6��dђ�o&���� l��4��m)�@�(ہ]���`�7ͧ�6o������s�dp��x0t�s�p`��2��(��f���dt0�b��cp�ļwae�r}t3b���/�ü�ch��s�����/xln�ru���[cܺ����9m��$�gd��n�d�s��멗���r����p���1o�)ǭgiv����ac �fl� [ʵ�ct ��� `�1�k �����0���=�s�� qɸrp"��$��[pן�e������� c�6_�׷�" �ɋ,�`6ә�f�� g�$g%�1`ۊ/j��̺�w��-�u�0�‚tt>�ԁq�����6��$�q4b̞�b�'�l�qlj�8�ul��[ulę��[j�[ `��r�]��ǭ���eo�g��{w��c� � `�p~كf\�h:����=���n�#�sa �[me� ��s�����檒���r�q��,���i.�&�c��cs�����l>�1i�0�[qi fz�9:��� ժ�r8@�m���n_�� ��^�[h�po�@���4�z'�t�au�'�s�)�%�k��%�#]�������/�� �{5��lf�� ���f8v�snv}t����\�-eg�w͵�:u��� �� 0�uų4�`�tr�@ԋipc���!��h��f�e�� ���r�ym�k{�ٶ!��:� ����z��_�¬�u��z�m�a�)��0�h��at jn�xkr��u��8k�1 ��jxz,`�bz��l����0�pڪ1\���to�}�^fqq��� "yj�,�� �j �p��b2�q �pܰhk�t��י"zg��k�e6t�=�����o�� ��\�7�s��pscq�~�v�jv<;��v<���gч�:'1\�\�f��(�٣e0j }q-��h�r����&���e8'�x� ��_}���i@�v�abq�b@�*�ա�e\�`��8�n4� �ݵ!�)1��c��s�߻z�ks�:��i݆2�`"�l:�ó�ԏ.�b��ã����<�ӷ(r۷l-�������x\�*��ĩbtf�4�/�x��cn����'pk������],��b�/��:���o�g1��)h��q?���r'npt c� |�����\�i��es�/m����"���pvee���vu���j���ա��hll=�d��x|�=��;�i�[���vp�c ��d��(�&5=s�z�ປ���a,��q^5;s/�j%��u�]/�o���_^�<��σ��u�dk8��#���y}@�z[ujsj��6i�o�f~���7��?o�ν��b��#���g���;womy ? pu�̐� �z�v���m��/?��ag�3��hq*�p�c���k����sk�m�������c{em ���ĺ�fk��w��*���� ^�m�i��5 c`bkndm��dh����ykexg'�e��ǵ�꥓o&y�� ㌊x\5j�'k4x���n���|fm�c���.��o�k6����>�wu��j��b[���;����z�&蛏fz��lj��:uq6���o���|nw��k/�5d���k�p�:�v�p�r1�k��5$�:vj�n߫f�ۑz�.��b߭���-� �^7-�0o�5k��ۍ�` ��f�a��64� 9�/z�zk����r�l�^�:�7mgh����������6ow�?~�ɠ���zt�9�_a/�-�3�8����du�w�c2d8)�c��պ�%n1�������'����� �� �g�[\�כ�!�^��u� hr� b�b���g���u�myd����-��ܢ΢��^�> ϐ{$����jo�)��g f i������q8#�� qh�0�,^q�jd�@����w�#���6cr� ��4)x�7b�5$�z�g\��b>���p��kje���qy���fkaso��[�/�a�pu]h��l�a��b�����u�g ev]v���t�k"vr�0 �3ӱ��_���xb`�u����8�b ���xi�we�5$�i��% hm}}́g��\ȫ��&�,�Ԭr��k�և�.t ��#j-��g/~�ҭ-��3=r�pc�l����he��ޚ����p�rc�lϝx6t[���� �j~ytn�pu#��vdm���]���d ���*c�1уj.!ԑqn.����'!�1�s�0�n �� u98�w�qtz�w7�p�=n_���b>՞z>���r�rng��`��u�/��&󀄤`�m�.����]���`����� du�|8�y���.����w�7�e�}��q�;���asl"����y� ��0���j ���* z��`70p���l� ,�<� �܈�)����j|�y�wƣ]qm��k�c�d�jrfe꤂$�*]�&/q������*0��%|_�k@��\����xe���|�uk-���:^���5b�ٌy�-��v� �dm��pv�<��� >� 5���r��y�nw �/� k��� � !��l���br �m߼q�{��acbqr� �������$���c���m]��;�� �o�`rl�1�ǥ1��61���w<����-h6}�p�.om 2��j�s\�7��*�~�������g�4�p`�; ��k����pӂaqwר�v~����d�l�����z�"��`t���%��9b:n!;�j�&)�(y~���� r���_yza ��9of�r��f�g�g��$��j v�� ٪�k~�r�s_�\�nx ڨ�����gx��t��܈����q ̟b\o�s��h�b0�a��,@�c�$�#�p?�p�ӿï6��ܲ}6�x�)��>j�(��vzy��֯(� -�!!\i]km�2&g/���p�tƨjz oa92k�l3�o�.��.��>�ժm.os7�ظvyqpś�����]�)����/�@,d��h�4˥=��_�_�c1s5 u����pgjs#elx����(�e���ki��&�����f� ��צ��p�����(�� �t�t�eqp�"w�0�����ә ��c�*�wq4���l�et-`<���π���3� ʩ'&҅�~�w7 ���.out�� ������y��=��x�>stprsӏ� ��{5�t�m߁#��btbyy�]ŷ�z�p��y��htm�-5�\� "f7֚�t w�}p ��̈́#�ai9���tf۲��_�,::)��s�h� m��mje������0��3x�s�ڪ�;�v3���.��6t��s۳o��/9�x�c���t�7*�u|���ld����1%�q���8���`wa;���=% d��ə���z����5d�n? �b�!q~s"8���ё�%p.�b4ƀf��o� �ܻ7z.� >�5yw���@�8�k:��j��oc��v��vݷ^�kob��f�n��1���`��m�e�"���դ�w���z�͔xn�0v�hw]�f�v�(����r$f�١�v��`�%�n ��'}�؆�j5���_oi`�x�b�y��4��uzn z�#��z�j0�arx��eȩr�;��pg������,��آ#�g 7������m������ �h�u �t, ~ᇠ8~�nr�o?�'�a�� �-��`���hu��m1?����~e���כ�ײ� �b7kǀ���uh!~a�p[-m�ko�f�փ���v�0����zd���9س�xki����!�8��l��j��m۰s�(c~|�s�ˇ��}��!^� t�������h�m��o?dz@l�$7���p�ω�0 ���ȼp�x�:�vql���3fu����$�ő�4�i$ó�$ʦe��4 ܋եe�6��d\wh��4p7s5m�o)�h����/�cy��ҏ1�я� ���9߄=f���x}�0'��; bv}�u����q��> "�g@\���3������c0=� ��; -�� �c@� ��` icxt$�{�oн�c ���1�[?�u[��of�b�����|��fy��"4�� ���v8nd�& ���d=�<4"\�)��jp �np.�a�9��������5:��3� 8���10 �,"�foi�a���j�с���c�."x�i%�������ǭ 60߮d�x�w� rayų9�,�p�k�(��_/�(~b�[�2�ve�a�qj �0?l�&����)g������ ���-�v���0�y=nb {lh�w*j�r>d.hl�^�:b �~�e�(=�$"�f�f�l�*�����z@��8�t�x��&�к�{�$u/9ƈ�[ު"e��\m��j> u--�νyej���b������?$���x&`���b�ah0��m0������(�p��m�o �#��sv���!w��$y5��}��za���9ac�cak����������  �� a�m�lz�ѯm���9���27��#i�-a���'�0-���γ>zr�z�� r��y^�?�@{�h��{�*�i<��� ��kn9�vd��hk�ԉ����g9,-�c���l�vk��8��@� �:�ݘ���k߅o��<���^��>t�%:g��k�mbh����y/��b�q�>.�)�i�!y|�sfɡ��c���?�q���ʧxlh�$ q�d1�1��imo�kgf �q��ta�$il2�ܗ��o�b�k{x�:߱%^3��ф���*�^5�m٥f)3���v����p\� ]�hh�x�خ �x ��v�v�����џ!qq|��w����1�� �)�z�\��hsh� �4�k���̴a=��\`u����3���u[�y��y��cˎeh81g���ű/��b�ü�b���dc=��%zk�o��`u�֜�omu*��1�r���o�%��jfsg�������ka� �����71hc� ���ns�y`x�ad o9�[�~6�f�t;�3y�x;y���!�v}&�t���%og��o�o��n��ǹ���r����#������v�wp�g� %t$* 5�չ^��|lv�x�� _�7��lh�^�ܙ}œ�(b����r�4`򓹉�f�r�e���1c�'r�k�b�i�o у�)wjni��8e":'(q���9ª��li��1�w#i9�h� ��q�z�oa��m�c��� �7��ٜ<��tc�a���� ~/-er��=u�o� $t�ö��u���y\1v��m�1�nh��/�gu6�֋֢����j�f�<������~�^�����p�������9����f�{6p�s ���>���d�!2f�)kj��>ug�)�v�bbx7���og��he�<�e~�hk���k�����&�����­s��ehz�q���a�#i��ߌw��vh�t�嬡�7�tx����8�&d��<��!|����v �á�e�@mπ���ӈv��ic��io7�t��g<�n#��l�^tsvwe�g"iw���_���%e�ޮm�7y��ӻ�i�'d����n�&cc ��s($���8j���� ��#�"ugrt����8q`w�5vw���:oce���`��mid-ͧ�~z���2ع��9����~ltݹ�]�̈́���� !x���g/�d��!j{��)�p�] �u;�2�fn���(zȭa�7��j�;6�n���i��ʈ���`�5��v���b1ymٷ#�4hn�m��3�ȩs�!�*v#w��ai:���9y���?&�h�1��sf}y��c.7؟����~�*�s�]8�� �z�n(ꔶ�c->�fұ{t{��id���!�(�t����8�c�σt�ba��h���n�$�ۍi��4��������@�-n�ks1�s�;@��͢%b��)��#'.\r���o`�����ݛ�g� �xi����0%-��gmr$�gz��2�j��)��l�'��$r����m@���ы"��x�y�ǣy�p*��@4k���qh��ol����i�?g3j�mޏ=��u�m;�r�i��mfhcdj�8o���s��[�_�e -�!�����!�rӹ�����������usd�>�m���ar��2��7|=4ƒ;�އ��kq �6z�q��0���\�c� ��,�k�al�h���adq�-��w��g��;����m�d���x�5~j�~p�z��az1�qt�����4v^=��!r��z���ա��p�x3�s �5~�q� b���bγ1��<��u���÷9�w"�m��iջ�im�a��^�5���y�͗^� �5�nas��(r�.��������~�&���|�/�����إ&n�c��{�]� n���qsd[�1e�.�����g� �.�c�h�y��l�_���è��&� �f��\$��\g1׬�,�.o5��`fh��%�'��rjy ��_���"i�f|4�}�"z-�g�#�3�@�~p$����w�$@1̖���ʊc��v�4hvq˓#x�nh��`���$5c�^ۡ �bǝpߋ��u�@��n��� ������b�#(��u�8w���o�<�t�is�@ ��٘"}q�c��"��r��nj��7j�n!t1:o��l1,w��e� eɓd}e��0@u�y��n��x��zk�l�s�vԬ2�~u��[%:�e�]� �{� pguo�;��n��z�y����$s������8���l�уϩ��*\'�5��v���o��:��ӷ�5�b���`�w��mw�o���iq��e� _\�c)�^n��f`n�ukh��� �$�� �f� o��&�z��� �įy��~��œ���ά�0�lw,xjx��i�ʨ�b���2"��f��y���}qn@e"������u?q�n�� ��p���6 �d4y�"vhcr/z�تsk��8��z��mׅ��&)t9s���]cr{@*m��e����trݏ��p��j[-�� ���z���������&)��_kh�����%����qйj��s��e!�u���)�_���bb%p)�߿b������9����a;�n���y����c��ٵ�q�n�ղ��4�i�%ye��ê�i'@����}��ϩ�,�� e����t�0a�z;�:�a����5�bv��� �טd�ڬp����r��"��ŕ\0_e�ea�x�����99�֋"�@���j5sr�\ a���"_w��o�y���4�����:v� �rs��s�f?y��/g��m����� '�͵c��>��w��q�m�"�u�� �fg9�x��t#,ai�佥��<`�c ��>hez鏮c�ps������o�u?�xkb� �a,�q3�,���y=ciq9���!i�����#?�z㚠eə���=qr�n��\���0��a4jj�g�v"�~��fk�'���d�v� r��,a�4'= 0�x2g ޡ��l�ä �e٤�.��� kj��|���цr�>�kv��_�go��m�����)�7e���az�e}�a��������t��[#ҥ>h��&w��j�8vfq.e=|u2�m{cr��~�0�&8j�n�d�a(�x&mn<������("-;<�,yþ�=���r�~�����tz����\��9�4"�cm�����x�um�zw�s��t�z�i5���~�c��u]�%v-�o�v�:ӳ��e�x��(<��d7ȧ�u��!�q�гo!��:c�l*[6w� ��m� f'ʗ��*��4��ٔ�d���b��β٭��� �j%�������`h���,��т��]�k�)��d@x �k����ŷ�|��m��nr� ���3,�4����o�o(f�8l�p���on s�z�s�{n"_��o5:v��@:@����]�s ���͈�c��pjs��i{��� đ�d�wv����p�w�t�s�%a �k"���!�\㖪'���#��#���jn�m��^r6�o$d�o1�����"��n$�b�)�' ���ⱙl��x��e��������]��^x��������s����۲e��h:�4-9��zh�(��՞b:� ώȗ���es���o��m k���{���5(�a�z�1?}�u'�������[��ab��@u� �7˩���2>��nkp��c��`'eӈz�,�f(d�fw ��l�a��h;v���h���z,č�iaܹ�����ٳ�'��;�nh��� �f!w��������>חf� �'��q4����#g/�li��|�xm2�y�v�~{���� ͣ��43�l-e��?9���և��2z���x\#����v�q����5�u�z`�78�u��^�g��kд����hv�ߡ��4a�a��gj����d��h\o��e�s}�^a〭����d8���s].�k`�uf�xt���:�r:��*��&� 3��^з������������� } �u����� �o@��s��t��qڜ0���o��e �z�u������ه����2jݕ���l��}�j[�9[�w4�w�ޢm��d 9�dd�.��������i��r70u�>��-ԝz��v��4���p��9�q�`ka�t��bw�c����^[���)��m�5_��j-�f��<�}x�>շ�m�����6���\�3e1���t_�d&��� ���z��o9��z�$����w;��z�������d�^���ڱ �j%q��/gf�i�) 랫>�^�*w��4���/i�~=}"u_�m����h�mw���y���8��zd��* 6d�,���m��i�����j ��bl��w��{�îg�2���y�l�ck��;���� ��o�� �;���}3v��o �f����4k���=�ۀ� ��k ����������v����h=�5cv���ȓo�~���}�=j���^0�� ѣv q�бdtjhm�g��ǫg��g���q������fqk�b߮4�.ƿo� ���'��ڬ��[�*c��k�b���> l]40;�or���ƴ�?h9:�zq�"8�o��!�@�,{!��^�qzq����g�?e�ԓ�7�u/��}dv�g�ms���]d�!��q�����˺�wy�m�x�~���qq9j�> z�)~އ9��}���k��\v�^t�w9e��@h7�� 5���qcf�g>v����:%ٗ�0�_�m��i�2v�py��p ؇�d?>{�r`��z1��n�@���w��� ���qm4�_u�g!�mrq� r��5su�1yp���o7]`]#dc���l����w���y ,x����}_c0�� p�` �s۫�ĉ����t����� ���|^�=�f�ua䖉ր��zv��9l�r�������������!`gr��2���}�f�{9}��]q�4ѧ�hi� eta�����=�.� �[�т=yt�sm�>���9��jp�g�@jrc"0� ���lmp�����!@���p0d�(�ye�����_gݿ���:o3���%xxgor��o�ea�� "�*eye�\��ueh���|�̂֟���9��?b;@,�9ug�'���h��s6�z:�y��o��ynke��f�jw�^��>��7����on�il��7[ݻ�m�/�bў��ޡb[s�4d.׫���h��]��3��p�ce x�������k #�_.��3���ar�1dt-��pb�p&b�9��4�u{����}�k�'{�l�4d r ց� �p�t���> ��,��:�x���>�<ܮ|p�qh~�ƫf�� �{�!�f�]"�f��������(zr������j�bcv��am�q珰oh��sd�>4ny��&��r$j0���!q�k/`\us�e�3p��[g31y�e�؞�1�x`e'ܾ����)`�l�10��f(����� ��4�8a�h��fx�su��k��f@�]j�zڡ~w��/f���!���w�qs �l^�z��af�j�o'�=�l��al�r�u;�_�f�j!&x�l棺���h��n����'2!�����qz�n^h�ժ�o���3��팈�׃v�qt'{i��h� �ϩ|��a/��ą���ԁ�;�e-k��{��j9td�)]��jd�p[5�n��0n��a�;!`s(�8}�����z�\��v �kk�4(蚎�oq��0�7��_>ŀr'������7^� ���_�j�,6%��ޮ$!x�m"��>zwԡ�k�ar�5�ew�ij;5��pa �%oh|��o�ѽ��6�c;��f��mmst|��u& ;ay؞y0b��(�z�e� d�kj!b;h��:� ��5�!�*�(�# p0[%�*"`�~h��ʒ��n4͈t�0�~�ݕڊn��,~��2/�3}�����i����p�i���l�o��%:�{_ %y*����w!�p���#� f�0��go�b0�x���j i��p��t�����c#6`e8`=b#vŷlk�nz�]?}�̍���u>g� ~���r��y�'��}��m��w�j�*������t�џ�"p� p 1�j��c�$^#j������|���f54_���t�3���*a���mkw���� �ζ��m-�n����]�mx��їj� ���;}�ܶ77����s�� ^��=i��~����b�_��ŗ�`ks�m�1��@�x ��)��w;f���ar���h�2x lz-����b��q��=�[,z��>�ƚ�a&m�s�,˰��>�� ?����h�hde����zs5ӹ��b=a"���q���{�c��v����j���;(%p����~yߕ>��η�(���,#r4�,�r& v�ed�,a փ�:c�9:���� ���ua��1��bk�10s���i�.��gmʖ�\6�u��z���*$�ǐ�s[ fu` ^�j���`����� ���lfc�"p�x=��e^���d�[�e�b�^�픳w�8�*� &�����.f��1c����������ee]�j�8|mr�n��;��d��`z/���[���q��gtu�(�!d�>�iȋw r�k�ik��� p�dp�5��4{>�����bek ��^�� �ȥ����`�е�}��#�m�[d����?��\�3�a42�*�?����������o?���σd(ght�^cшa����cd���f��- �v�蒁����jt1���b� :y�uoj��:yh�m�]� ��ctn�w8o���7�w���a=k�8�qܨ�# ���g:^xm��d�z�k�hb��'䊗f�ެ���#wi}� �}��yx���i���i�i��0��q�ޅ��x|�brqx5�j��o_u�� �f /���u �o?�9�9�j���� =��#�l ln؂@֮�p������j��j9�-\�����o7��v`�n��כr�y�t��|���0���ōxhv9\���.�r��^��3�z��5p�m�ڼ���/^�ז�4���0|��hfa ����g�qy� so2,sn�޿q#z����[z�v���6wv� ���-��j��ߧ<��n�i�䉄�q཰���>��[ x.0o���3�[�qto ��l�u�e$��w �p��� �sc��7h7բcq�-����l8���w��:��7_��jvؐmp�-%"€v��h��� 1��)%�˶�g�nh�v���ѱ�~����a _�{va$�wil����ʋzuh�>b��v�3..:�4*~]cr�~3��`5q""��vgi> o�v��h�b�ܼ��|{>�>db �{�':[| s�e����ea����8�d�a���5ԗ�#��ګ���j��u�� xp����mpx�!k'tãđ�x>03�d���/n�oq#&k���ar��!,�y0�o��h�z��kqz�h��s(�i�r��֒1p��ex ��9 *�ȸ��h^�<�� pi�4>���h�[���@����>�k���a֢5��}��'���g&e d�r�6 �2�[&��my�s�nc)pkk��n@���s��qu����r�m_o�_kur` el�\ōꬑf�&��́�ffs��mu * 8�ҭ�2�g��a(w�x��b��{�_d\3��t[��*�89�x���{a���zh��.���-\n��*� �!���)�;�&��wl�u�s� �q�3m��}��9֢=� ���d_ko�� {&��.ya��wu8y� ���-p 遏��w�������7ay���x� ���0�s\e�v!��s���d��d3�r��l� ��λ ����ox^���nj��dc*�����f���ڂw:�q�!�!�3���ȏ�3�l�i/)l��k�% �~�p�["a ~#!v�;s��l��}�>a�=�dh@� �k. {���������/��q�a\({���p����(r d�k5����w'!a(}���y���.ᔃ*ǘs�^ƙt��'�@��a��o�x�⿿���t�c�oo��r���z�rض-7��!vh��砡 <$���$#�9.i�f�૬ n m{z�1k��f�rx�j��|)/ -�� 2�wc�x�j?,�u,�)��¯��dng��f��_]�`��ѐŋ�^�!����ձo=>�g����`�� f�����y�h1-����: \���|)hh�� ccn��5ƪ�@�p0��6��56r#������v�� ���tǜ��'�ʿ�vzt� �|�,�٨�#�_��zm���h�r�}�����@�����5(l]�����r�k�����a�b���**����yn���$�ƴ��*kh�yַ��@�:mb���"���e��z�h!2����(r�)�.�z5����(��iu����]����l�!b�.*��!���.'�:?c�(�y |zer/��'��1 ���(�|ͭӕ9}�og�a��&��5��ŏ��q� )���ơe���s����۝ c��j"ug� #���n�"�n2����0�xs*� x1)*�mi ��t�j��œmk=�n��h�a��ֲ�s�^��i�����|�r�s�t��xl��|��;���&��[��pp�%��_~c.�s���oug�p�x�*��p�-h���s� �p/�z�i\5��@*1�ë0�ǂ�q�f�l�y�$�o�{t�v�t���1"0�}tp��봐 !n�{=����:�xa:�o�r��t�#��ƈ"t�p�#x�m�d|����s���$d�3�a�����&��?g ��>kgw޾e�} $������?r"w�o���\�x�d���e���c֝���],��h��1cb]�d��.u�(���2��ab���ds�x) �y����u ���`��a��/�e}.�ɥr[u��g���q8��m�s��]��r/�&���fsh�ӗ��d �j2s⌳���l�n��.)�d!� l��;��~r0������\i# �f��!�]�~�a�� w���s��#%y� z����ϟ���^��8 u7�nߐm��w��m�)�;��l�brj�fbb�[� � �!� �w�u��7h����x����a�ѹ�`�c\``p�[u�ō%�{s�ͷ��-uۯ�>��ppq�kbmia��>�r�)�wq �}��g-�a/p��#���nu���s�j�:gu]b��*���ۺ��a��t4��*�ŭ�y���h����/��w9_\�l/���,6��r ǯ>�a���j�3� �gq)g�x*xu�&pύfq `, ��d� )ؽ��$�j�av�|t������'&�s^!g�����g3ނ*��-)��fb�`����m �i� �p� dg���l��eq �a �b �δja(1�f]��r�i��*i9�s��<�b�$����s �5qo� �l�����i���u�`,/ծ��b8/�z��c�gp˒:%0��j�pb���y[]ꀉ[:t��ç�t��nm j�"�ez�� �7����<��ӓ�l�&�]��x̿���or���=|�z[���9?dh�o� �c�������e§�z�56¦ܨ�����'(�]���gf~�w�׍�x����z�h��j��ɍ2�vn�����s�;�% ��2�4ic��jz��}j&_�oc41v�8o��j�ے����a������)�6x�ݑo`���zw$���!b��γ$��: e��g#~4�p�8�����l��ԕi s�_=-5�(q$����f����ιtē�z��s����z� <6�)����o���w �|v=�i�ҹ��{�u7��9ii)�ȃp�������ł����d)���4�j g�s���/ё��>k?� ����k�d� �:�x�c�o %�xe�.����j@���t��~�mv��྾ �����o(�mmq�1�� �y�g�`��r��~g<�*����y,������b��m~l۪6����(*�j�~��߄,������4ϗ�,hb%�j�j�c>�x���0}���io��"� b׋�h�:�}�9)�^��r-�j=i�pp��7�e�u�j`�찘� $c�����)���l��g��=�`� sr�j�����#;���g����w�ە�jm����=lz*|�d��ԇv�mmҗ�"b��#ȥ���<)^�x����mke0g�h �x��ů�nrǔ)s� o8@?f�uhqn��''�jfѝ.� ]0y�d�e� k'�]%i�,�otx�@����f�q�d�w��6�v�ɧ�uv}�ȭ�5��xj �"(1i��$�k�a.�չg^ïj��"�]�<�a���q f�u�'����'lq9��1��p:�qy�t���ck�e;f �^9ٷ��8�����z� mc�ճ7�p�gj��o0� ��9�� ��c8 ���uף����5��b� ��t�ٵ�u��nm�("e� &��؋��c��΀��8�=㤽�v�/��(dɐ���,o���qp��}d��d[j���} }�����lk�y�0�ġ��t=g3$�c�/e.j��rօ��y�zs�)̿n�]�걬5����9��8t����xw���(v���b���b�}k�c�~$���9���-\@b}o8q�<�b��0�j�@s"iʳ�]�zir�s�k���{����� #$�����d�ȴx\�'�tu3 �ѭ�b"�ڜ_c�o4��{�� zx�qй: kf_ԑ����:�ũ �hph,�t�_�n�}��q�g�)�g���s�,pm�8[�aj�>p�x�.�{a�#�5��&m �h�刬j� ���hk���dֹ�-q���j�!� 0t8ƛ&@���*3�aڿ��r�a��i�;�/"e�i�a�� w�@���sh*�6�ƕ���vw: ܣb� # �ΰ������o��3z��� .d�h�!1�<|-��&>�����;dm-/i�'l���etm�.h���3�ݕ �s_dds�ۙ�qk����d�rw�8d/g���������s]r�����_g� ���������zumǒ?����vɞ�vy�������j�a믟�c�f��o�e1�b��e��!� �v�� � ��2�$��8�w^�-���b���ռov�� �檓������p�7u��7�{5� �\��юn��bq����l�rw}��7}�ڇ���r��x_�nm���qxƞ�5p�i�j�7 �5j6�1,����z�na'g3d�5(�nx� %*-��=>���� �l̺��܌;�80�6�g�~ �j�c *��x���&m�gf�fgv-�� �v�v�vd�<���qx�<�mia���殶7��h��0 d�q�ɇ��b�h��e� ����rwh�i�nf���!���������r.a,��tu�wwww=ea{��,���-mz���<�rժ� 0�#���ӣ52��j��wo����ì]3�0�9�� ���]��g�s���rr%{����`�w.u��p�x'�*���s��� �z_ҕ����w4�k Ԯm הp^ʃ�� ��������=o�b��;��?7�up��`���_�qw�[��/�����[�dm���zլj �z��:��l/fs{q���ffc7�`���;ۮ��ʚ���a/�ee�z`�l��k']�؎��2����8���yw[�m =y7pl�"h�y�hvj������s�ӡ�v��:{g넓o�i:�j�:-�$��i��d ��{b:�%縵�e�yx��t��dygcц�o��^��=�w�� @둙�9���$��u���d<:�j�z9,g��)h�7�b�[��ĸ�dzq� �k��m��xk�ea�/�@/m؏(���8xx\��� c�w�m�/6���n,�=�h�5� �v��k�q �e^ϼul�(:�ce3�@w��,�z$w��=�׿yn�gk u�u)� -wb��ǒ�~w�tl� �^��(� q΋�� �zg����3�v �k�v���j�_�{'�ߛ�:zib$}0�� w�ry�t�$e��c;�e��]i����b���k萮'y%���h���i㵓�� ��m,�۔�dӆ��4�|�r�m7w��xex�g i�v���s����qke.u@g�h��i����%������t�w�*� ��w���&�9r"y�-q-�p�i�}��5�����쥬�gј�![d��~�@�`6��7w�~�v���?m�s�j`�`r�3���[{�.j}�;�_h�ⱥ�u�l!>��a�ق��`�_�p|��?���gwl f���i�]�l��3�, ��ss�v��1����}���p1�d�֌/[ύ.�h[df�d���xf>�/�,�b��r���3g��" � ydw�_��$!��y'?�-u�|t��c��:�a�8g��԰�q�������d7�zɘ�2;�ln-�0�2���[yr�l�=he�a�'6�q4��3�\��d �n�j3\�ڂh���~b8ķ�m?sٕ���1���v8�t�b��x0��u^�w}���4���&^ 8yի�])c��xw2�2��f��i�?�##o���yp�0�%w��e%}6���kv�1a��{��|�ȳ��@�"m��w��jd9u�6 e�ja#���|u�m>�%�/1�o�kf�l���8�'l閻�q���ѹud�ڧ@�,�)ķ�s�i>~=����]��vq����s��뤵i�_c3y{�y���s�7 ��]�ⱥٯ�z޽��촵m���!�0��mk���ݫ�[è�q� *�����i/s�f�&�q�@�fz���ǭ�z�ys�nf��'sӵ^ox젹����a�ꎀ��j����uf�;`9����&���,]�k��x:=�џw���ֳw� k�y�v ����;�]̦�u��#�^c�ˈ���:��1 �i�t� ��� �����.c?��@py�y{��k ������փh�e���uä �t���2�7,ѥ�j�ŵ��x`iv�'�m3�]%d �� �j�!″ׅ�4�qʲ�v�t߼��ʗ;?>/mɉs�[s6mp��hv-c� \n��mm.nm�|�h��,���rfbr��9���f(��b#� ?j0�g$ �v�� �z��ifvpb3/"�>j�x7�5�_����r��$n{�:��50:j���t�q"b��ҏ�am�w�m�c�q��iw�ݝ��1oi%'z�,�����õdo�l/q_)���lo��'l�'rw�z����[��–�ai/��}�&k���ea�����t=��ep�i���g8;�  u�=;} |����j�p/�ޓ-q���έ����m��,o`��x����w'4��x-̆dv@��n��/��xi}"j��%��>���6cx�}�=�h��]t ��m�x�s ���@�m����l��w�v �fm�= zk�t�����*�x�m�t33�����fdk~�9��vg���k ��կ[�ru�r1`�����wߴ���vdi�������jc��-k�֖�h�uϭ;�#ր]�@ |]�&#�2�_�f�[�|����z�i|�g1ce�nv�v��x쑰n�g�2%k��(��� ���[�_��f͘�d��� ���������f��ё��tgr$we��vzf�[��|�&z�� t�x�uő���@] ���|�5ԏ7���oy�&��0�ص�^v�u��s���z���`=�|��3��>���qou ,��̐^z���� �ü��ߓ,�����֫����r�����^�";���lr'\��]t�~_}y�z�_n��p��(ъn����x��e�h��y;���er������,;u�]�mi����y�l��%��ke�_5f��8�s= ,5�t��ϋ�%�����o�'�����������7"�v9�8 ,�ޙ[�*�m �l�u��ff�f��"�ֈ��sv ϧ'�g�#�����k��e���g�3u�k,�q[��*�7f�k9$�ƥ�nώ�q�)�a~�hd(��� ���hy��7� ��f��b��76u����v���\$��9��40���"hأ�l�g�?1�q%���4�th�hm>� /-��c�wv&\�1�|x�>�}�6�2;5�l�a��(9}~��<�2����7��vk�#2�&a2l�@q4��yj$�  ���b�萲s��v� i°��ָ�3��*��d��(�|�ߏ�/����h!7uk'�c���_gzu �ϧ%yqr���u�|��m�k ��fp���j��4���8m�4?��ŋ�=�7qpn1��<�ܧ�x͏��yi��n�b㰼�"js��rh�f�4g��bȵ�m�n�iu����\�юj��h�z�#�*ˏ-��@��s��m;3����§{^r���g�p�#!$�z5ֈ(r�wu_���ij#�x�l����"k<���������}w`����&?�g5��e[w�h��!��9�r��pvi "�&/���3`�c2�`�,�t�]wf�����aa9�f5:���'4/r1ƅ�'���ō[�dn%�y��q�g�!�����u/.j_d%o�8���^f�pq�p�ce6z�h���yo��5�pa���v/�i�m�w�� pw���$�� $62x��ϟ?�0�o}�,���x.�� w�c��f�|2�>4����@�r�vu ̽��o�b���k�tn�fr�'e�l3��q���┿ �3&=�bc�8a�����2��=�v��c�g�% ���/�qqf��lp�a�>!b��1d�ak ɋd� �e�=��2�x����nj.2������c]���-�s":sur�*��3�ak��[f���v:���j�x2��21|�6���vkp���� *�-�5� #��x��a��r�yz3y�wؒ-_� m���|���iw6���}�e�ը�����%�h�����^�r�s��$ ֹ� �?j�e�ys�df �`�n%2�`¹ch��(�p�9c�~�kd_�b_�?s[��uw���>�<�6����؇;�^��/s|���g�o� o��=cc�o ��6:u�' ���s�f߯n��k/o��4�2�~���auzخp)ҵow���m��6���n�vνiyi��m��yr�7��*���ݚh];��k&���3��jp���b��n�xe[ݞ݂wd���/wsk��lg>w�ý���,�wk:r����[�8i�k��| �88\5$��^�ddc�j���΀t�i62(��e9�٧�7��c}3���g7o�>���ٹ�oc�[<�d�5j&��ww3�y`���sv3���k������dv!���ghcq3$��&���i*gd���� ��q�d\: �y�ni��;?�f�1�^��t��@łͤ���v�bmo>��ê �5�b���x�9�a�ϛ�=m��a����j%w����pi�l��j׾�2�-<���5ڞc�!.h�w��ktr�o��g�$)�k?я������6(br����y�pj4yjx� p�x�5]��0�¹i�qyo�\����xox��h�a�� k#��e���� �[�ğ}��j`��p�u�ú�z*���bd$�o��m�\�fs�����ѱ����l���a�2�'ߙ�k6t�m�_����h���e�|)�ӌ'�"rd.���w�9'?�v�ȏcyl�v3ϋ�p7]�[�i�$c.mji�2�v0#�1���-����t@on� y��y��g��u<*���)���7���pt����rz;�o����4hȥbr���?����cw�fӓ]o�p�� ?�o-�mn(��~z#��݁�'zkh����g�8gs-�����'ݮ ��f��)�����d�n-�m�|ml�y��ѥ �5�tr��%��u�zku�j��de�b�i�a�6چ�|�->��|���?�fi�� a}(aw��m��ȃ�v'�nx�y�����/xy��y'�� tw����ħ5k-c�����*���i���"l����i����:���,�m~�~˥(m4������3�o��9��7��s6�ݶ������-���� 1u1e4��� ��f��<�hc�'�mfk�ةdҵm}�_�h��� 2ֲۿm�ʞ*��(�p���m�[r�ʈnv�xroo�t}k��$ r�yvt��yd<�h�e�n�^f��<���a3=b��p�t?��e{�g�2����"� 5�w�o�b�h��u~�n��~����b鱵��-�u��x����b(��~�˥yq۞�/�:x��c��޻��/g\\��r�\sdy��܇`��1;1�� �{�~�,89��,����( 3oay�_��e��r�"��a�e~�����fx��a[�a!�y;kĕ,�)h�m�i,��z�3tk��n��el�ѩ�i� �u��� ���irt���9��l������[;©ٯ��=�x\lzkxqc�c�� �u�l�ܑ�1�n1�����z��= k΋26�ee���궝-j�޴���=��a���&�-�lhw�a��ڶ -��id*��:~\#��w��� �a�9������j֕��[0�y� ���ԉ���n�y���>k7�e���k=2������nȥ=�?��z��@h��v�o��6�k��7�io�� ��bo����*�s���ԧ��v�ynх�wյy(�������[�t )k���'~,-�v1�z��h��-;${j����e�s�ò u��0vb�(<)n�#g�v,�i�td��9��n�k���������.z�hr�m�dt�h�]�!p��̞��:z�����?u?uϫ��l�7x���[�y���;���'�� yh»����chvb��4gc4�y7 nb=yf����h]�m-����gcexz�*�le<�"���~׫w'ե����՗��;����z�cif���i�śbj�-e���;t�dj���đ\̒y��a���/e���&$�!��ù��� !c��s������h������=�sqa~�_�g��x��ӿ�'����vv�,��gڏy#�� �������2;(5 %�x��� �_�y8-o���s�cdv�,�p&�srk��ں��n��� t -���ks�?t�x�|1�sf6� �z`ɦ�up��c���y� �t�#m&�6���. � g'��%���^<��t���oh�d������.q�[.0��� ko4j�k#5���l�h��u]4k`�4`��m���4s�db��b�z��c���[9�9s&/�k��m��f��z�¸�ajs:j��m]w �~q��l�-���z���<�~�z ��b��b6�1��-�y��6�x���z���b�3�q��2���$p<�o�qr1!�=�v:o��i��l�� ���(/߱2�wn�-�e�p1�;~ߋ�����['|w�ar�u�ы����$�>l���-7�n<i��u��a���gc:tr�d�1��v=���b#m ���q1t�b,�d� 7���k�o�_z�-}?��c�y�ddeg�e�:y&����ls����'��9n'����j<���өdɀ�����\�@|y�:< �6^���r� �;�;��ko���y�m� ���!�\#�a �@�ŷ�|]ۖe���~!#��ww�d�� @fv�c)\z�����l��4"�q�����h�u!)��gߔāj�����vd#��#�?:s�e]��r\�b p��b����ds�˶m6tso- ����f�p��ljr9��[�kj�if�˅��$��or�ŵ�9�b:i����s^��ӳw���pnk��5 ��-^ ri����6�t3!z�d���7�¯�e��j!��� kr����vx�{v�r��p*�d� ���� ٪"��)s�d��i��cb�nh]�h�vh��r�����)��wl)�n�>u=m�5ԕ�jjr��js��jm�(ya\_��bfڦ�q�b�䞋�ύ�(b�pk����ocpti�/��o���u]��n�� �w߼���k���.���a _��*i���|��5=����ћ���om�^�������룫��o������~�:��ꖦ������$�ć��<>:?��r���i~ջ� n��qŷ? ��ao2]w�~��{��h�m�� a�,��4�[#!р#׌� 0 �����smq���f�<��l����o`��ջ�g묝9t�p�x��d'��c�`e�r��c�'�^�qň�oa�>:}di�g��,t���e�_rz�3#���a�>����o$��o�æw���=�9� r����4���&ڳ�`������r��s��!� tc����pʟm3�z`k����t����v2tĭsw�� ��w���^y��=_� �e�idj��i f/���-`f����p:(�j2�|�r���g�>j���(�-�1v#[����z��w��n��cz(�9�2]��#co��s�oy��2cn�����7o�r�dq�;�r���0!�k� ��}��ёm�t �ma񘹕"�h�����x����? ��p�ς��|�p��[������joo����ly(�l�$�����m����`?y����m���\�qۤo���fs����p�����}�|��!��[fk-�r��� ܯ\���!�)�tu�wuqĉ/`��b"���(uj����e���/��6`rtw��~z�y��>� ]��,2��vl��dod�?��v;�۬��~��ka����f��jolϭ�\y�5��?.c�ȼ�«dw �hk��,����9�ik:ma�an��^�뙠#�x�0/o(4�ڬ��ڬ�<����]*�dw4ds��wx1.���㠂�ǩ̄�u2i�/��t��f`$t=���f߷�v��ît��yx/7���h���s��;����,n я� '�m�x��`2ٷ!�(-˞� r 'to�0�����o� ,�wv�>f��ݛ�p��d\z��4�l��r�,��y0u�he��;�밆j�3�~�9v����=k<�ԯ_ qsq'�u]3^f�h�v�m��%�ȋ|l�^�g4��ik�v� ���s���ٺ#���~���%a��h�*�q3-�ќ`m�e_��[:e���/����]�ja[�ޠ�i��4�1�(y �*p�� �d�f�gri������]�᧍� �ҁw��;����z���@��a�����rː3,��=p����8��f�&��e�pf�"�mӟ�2�4� h��$�es�����d��zo$-'$�� .1_�f *���g��݌�lm�荄(��(��ɖ͘ z���r`�������������r:��39�:ggn:�]�/�����(ݪ^i#sno?���ʦ��ߗp�����pk kt�s0վl�}�dcom/storware/ipsan/console/lang/properties/messages_en_us.propertiesխks�f�(�}"�?�����k��f�����y��l��keɏ�g�(���hw�iqn���o>����p�p$* 띕�����v��y��/�cq����.��2o����m_�զj�e��4m��/׽�v�u�3u��u��o���,��tm����e_wm^���,��7��������a�v������jws}�ֻjq^��)��jw��ٻ�g�s�^֫��7�cal}��˦�a��_q�y�7*���m^4�n�x ����w[z�te�/��z�@d����x��j����������}k���>���l�mwu�w��~w pv�y��x�����cb�<�y1���������`�������u�p ��=��mq��m�t�~q~]��uv�m �4�ﺦ�v���}]u ��l[���˪��?��]e`jar��' jq��ūjn2�a���*gⱥ��� �{��{�є��f���y��ks\�����ϼ3�[e ].�hsx ׻f�g���m�^wb��#�u��o?�?�~�ѥ�ȳpsry�m��~��e��m�"����٫ �dg�v-m̳6���k_���ٗm�: �b��/��?�|�r��� ��dk�e^�����{ y�m o��e_,��7��*>�r�ʪ��n�s����޵u����,:-�i2>�f�b�*�=�'�mceyq�� �or[����laγ8��\��̺]�� �ս��3�����_k5w�s�*������ݮ��z�ߴ���k� �-��߸޿�?�ҿ�~�/ӧ�j����d��v��}�).��*;y. c�wx�e���r]l�?���n�@�۾^�}��-�����}]��[������wx��;ǟânk�-u���a���#'�/���jh|w�r�x�?����x0a̰xq���7~�=���_ ��k���elj|�-�a��^-dҵ�;��@����[�����¸��^s���z���ڣ��>� �'�á���]����^hh��^��;o�gu�:h܀�a���]ńnh��&7����˾����~�u)mpg�w�߫6k�;^�4 y�d�"q�υ|� !v�ެ��gx��.�us�ž�p�:���kl�.���oïf]����`w�����>?=���&��<*���/η�(pvn�pi �h�op�|i��u~x��ş�2��l:�ʉ��'���╬�̮�����o��ß�7�* �\~1ͼ�������x�?�od ����=a���0�r��1�r�oh:[[8i�ݮt6��c{[zbǵu�?�;{��g�=�sw�!:�'.4p)7�#���hdu���'pn�l ƭa����_@ļ���q~�c��]gؐpdj�r"���� k�d!s�i�w4�ea:/w@`�:��bp(��7� �_ąd��l�5]c����:x������u�����bcw�� l��1h���=�%�f ��� hk��%@m�e���s�il6(u�?}�"�ߒ�bk=� � �{�bnjsj �v�~ ���wdc&m%���[e����̿�*_�-\z4����y�zc���c����� ڽ�诼%6��x9�f��jׁ�d��m�tbw�k�\�}����.ۀ հ��wf0!��2������3�1<),���m��=�{ԗt�1�0�>c� �� k��j����������#��ncq�[&*���knz�њ���u2ase�ٗ��f���pם����x�� �g��*.'�a��p�p̈́~lџ��ٓ�ԗ������gp$��ð}�;�������!�pٺ�}���>}���������ew.���7g3������o�ϳ[� ����$h��?��t^�wq7��=wo�{y�ڏ�������y8a����h�m�/^_��~��{��|�b�t0�d�p.r�%{�n�i�;qvų�7pqq�샙w��oh:�<��wy_}��*� !�(��oj%�/�)d1��v�4a��gt��,%x�qj���� %����kp,�py�&l���v �������09� �>�po<�l��{[ ���ҧk/a�q}t#�=�������mp�^���n/���2g��iyu \��v���&���db��se� ��k�1�\[�� �6��v�k���cd�2����zݷ��l;}e� ��7��� _��ƀr�/��d������'�q�/�:�/�� _���.�<�� w�,�"x2�@&l�y ��-q� �c����u�3���� �7���z@r�ay8ŀ�&o����iah�m}�� �j2�d���6� ?zrw��ki�@g~��? ��7�d�i��oփ��rb� �|`(�p[��h�ƀ �j[��-l�b�dm_�0�#�;v�f7�~xd�.�b��zw�� >�$w����@x]g�`7g��4��^�bݰ��{3�mg���"�>n%�m�6�>���v�7�/�܀�i�w��.�vݾ-�uqe�&n!tυ��0��q���v/�\-=� �����d?��d��"���-tz���w�n��3���:���<2es�u�j�u�b7�����f�l�n\y���'���itv�d |o���� ye���)��&����m������ì���7�3��[��m۹�s;og���þ����pn��ag�9���@���r���̛brٞ�}7�4���� v$p,���3��|ӧ��(?f0e�� 7�>��hq�f�c^-9��e��p&����gm�̛�$^���t�"/�x�q� j�^����^�����u��,d���{� scpj�gg� ~�o,�!�0��l�u��m�ӂ̹�n�~�ku�ò ����s��ĩ��z��o�b˽ �^�����|�*��o���%��h�n(��ce�r]!�†) �%�v����k��r$�m�-'��x�ts�gge�,�r m"��-a�8�x�6�up�fȉd( �7 ڱ$���l}�th�ҵ�{ �� }���1���5�g�����@����w�$p�7�c�����acñ1{~�)�-����!�a�r�m� s0 &~��_�r ��a�a0�(��b�/�:�݌��;��~w����� ؁6=�x�h��pv��d�ޑ������ݐ��#��!���5��l����u�|v�d����� ����`��u����ugmv7��-��t�<��"4.&z�t�(��0�� ��<ú�� ;rv>���p&�ˇo����62o2i@�z7�j�~7�*o34��]z^ ��� �g&k4o jp�%�(�a2|�)�؆s���q�٥x��#�h�w��_z ��3�w y��&kų���wñwtj�ia�bw��i3��t��'��.�\]��.�k|�v]uv�hjw�w��2�u��x�<���j%�e��� ���o��j)�nm�0�å"��a��v����o^;��xksu}yvuy�����z��)b�u��#�u����d[2g���ԁ,d�q�s|��j��p��k �d��}�=4� c.�g��mi���ᓳ���z4���>”2.>�����3��6��ў������jo/ �`�e�9j��1��������^�ځ� ~@�7�&p��p�w�.bgt=v)��pri�f|�� d<�l�p� �t~�����ϣ������z#6�6�_��k�%��b�귊�f�������@ծl�3����dsx$�3k�gb�]on1��ޱh��s��"��g�2g�a�e���(� �|fr/i� ��d�njk-���k⟋�|x��k�z0�ak�|�'j�9�������(mu=�x᳽��k1mgy{b��o���6?w` 3;�*�8�y��gw�/ɛf��u�¤b"�~�p���4k�o �x�g}�����jf �9��)c&%�����[���l8�������.mt�a�y�4w�ba��r�s�"v#m.��pw-����!$�ʷ��@�����e�% nc��k��ֶn�a�i�l�mk�p�նgc|��mb[x0��:�x��tk�/�!�tg�>�g�n>ihm�i� ��w&ɖ�����\�t �l��,t�mw=�1��t�z���nf�m��cx<>q�;<�!d���a�az>�%�_gil���7��,��'��c�}k���y|�a,��q,�8��>�����q��z��cuh,��ɷ���~{�j�ye�o��`��u!r8q����������a0'd2� r���]�c(�l�z�̡�|�8p�>�� ˗�l w�hʒ�j� g"=��h,�(v���k_n���δ��'stc� 34��c��ռ�ˇ3q�*�}z�6h�]�^x/� ��q�@�x{�����:���32�k���`7��9�p�'�: f�x��pi��2� ������ݶߠ��kt]�yu���f4�>*oݻ���������֫ ؈����f �x��ם�"#yw8�s�1=0ve���v���kmz:4�w2��i��|�ɲ.�)es��hӈ�����4uk� rjk�q]c�m?����d�0��}e6*�q%����d�h _p q]����_݇�c��)�c�fa�� ��.n���.� gx?vw� �� ��ר[�^g�������r�ߙ!ƫz���� ��!�n�mi1~l��� <����me_����-��t��[����ȁ�<��v�~e;&q^����-�pu����vd�d�&��cd�m�d ���=y�=���ߴ,vfv�?s%|�k�`���]�"��� >� 5��ɂ}q3�]_����չx�-���r�j1��z���_/� -ߔ����g�/��̈́�r �����g�a�0��6��ac|�~v6�ip��ϭ�іc>�v����vc 8�d˻8i� �>�"��ndtn�da�� �-^ïs�������}�) 0�e�",�����j���a��d'y ��ϰ�uu}^� ?��y&�vo�mv"а>�w�u����_��o�3/�á٧���p$ j</�gt�1^8�%���=����q "go< ��p�84�`h��t��(��bi�y��t�ݭ�j�:y!�u���jg�������:�\�������m�x�< `�[�c=�m��� �͕�r� ���a�ēf��v1"�h�=8����m������o3�"��yooa�� ���)v���(!�h ɠ1-e,���m�_.��|��s�p,��u�����z<^]�3��~x�^���v��� 2; a�p�wʆ� ?��\vc �g��dn�.�,��07��ed�wf���n�m.:$���o���*g��!w�մi�n��.��c�m=&i�r�un�pd{?p �ɽvx�j��w6wľő�_�&�$�$��j1����0�b"3$�'p������d��5���sꆌm��mt���oűoފ]ot�a:%oϑ[�!�����a5�w��ݤ] ts���ssl�9xy�]�[��h����zϛޑk,��� 2~�?1dtg4�1; ��νg����*b!�ciа]������ʃ����f�k�����(�p��$gf�'�3bqs�a�-�l�֖��j7��e�3� �g���#�,��fk)�rs���cθ.��q�i����v��!��z'����dzz��x,�\cd�n1f��e}�ڿɂ�hŗ`�$���ȥ�`��_we�ff�@7�}p�0�c�����f�nsdx�;rp�s&���r�5h�a�f��q�p���_fѧ��d¥&~<"�f�v�-/a&�m�1�m#����(]/�����丑�n9΄5�������| �0�o��1��׎����hp�3��w����q �_k�4y�v��lf9��boj��l噝)���:b�1z��w�h����hf)��ci��3�6$&���_��)���a��ѷ}smjg'k���� c�y б� _����-j�p���q?ԋ��e�c�t�[��򾕌<��fz�����솲�%�f�, k-�}i؅�|3mv��mͱ�ܖ 8<�69�߻m|��a�$�y�ct_(e/l���ϐh����eׯ�6�37y�lر��s��q���e zygv#l����\;�]f�8� q�����)l��*�m����0-��� ;lu�.�g;�s�o96u �&��j�.�'ay���f�{�25�2�[�ÿ����d�>2���{&�jl�v��vvb�����hp� x�>�wz�lrwaҏ8&������ȗ!�qr��*�66h�ٵ��m��ꏁ��\c��`�m5��a e�\����v���p��k2#�_�i}g���&qoq`�kxև�!t���f�k�3�"߰?�;�ap��q~�_�ה��p�z�:\!�4� o#d�����y�k���k:�h �e����&_� �@�`�l�8�����o�d}ms�vŭ�jdz*9�q-i��lj�®�d�>�w�)�}�e�t��,�ȶ��r���z���8v���#9 ⱦdy c�j��:��7gy[�׀�����6�^��y�rd�bu�ί������x#rq�2r��� ;�1ն��k �x��7��}5y�3����~�le7��%$��#e�$z�~ ]hi�!��� ��˟=zd*v��w�-�r9��ːs��q@f�㛿�qmػ���}�����[�g�ck�t��2!�|�e���j�i߀'"��y��̭v�c g��a�b�e|%�l�*-!n�9��?/$�4�d���>��`w_���;�b��� n���-�04 ƪ�4����ƒ�k����w=��s:/��t��u�{��)���h�z����� ��z�-���ѝ���6%��@���ē�od}�����-l�lub� dx���{bk}:���ǖ��fq�=3��іrf���8��=4��*����a�)��..���v�~kz(� '.���ڒ���|ӓpds]�m��'aqd`���!��� ��2�y]q]�h�d�j*�-s�:/��>���l�kb�.�����u���kvɼ}�loq��ɸ����{���ò�<�h��7���n�>վ���[��7��d�m�n����g�]l��i�����d=��p���u�������;{��_�o����k��4los�� ���=��с"�۶,� x�������odt[�����\9s��4����a��c�q�~"u�g�my���)��b�?sn!���9ƽ2��/-. 2󯉫�o��?=�rǐ�xra� {�񯡱[)ّg��6s#w���.�'�w�;�^"���gg1�hc�m1e�ޭv6�5>#���9a�c؉�(;u��=glc(��b�`zh��d.>w�͓�;뭰��9�u��l�fq �ė*�k�y��]5k� x���k�� x�?z�d��#� yy�n���j)]��oqp �������2r/�;y _$�ڶ�w��� u��ah p��`u�3_46���"�g1����h�g�τ�^�� ɗ=�dg{z����6��p�6 z̑z�u�yx=���]�r�7��7�#�p$��zd��h�o�a� �xghgi� �#�dkq��ͷ.ry �aj7tj'�q�e��k-&p;c�zn����;il*��3`4�z[j g6lj}:f�ro���� b!wwѝp#��4�$e2n�tl�ie_ƫ�ca޼#v��������.@r�u�����/cw�o���0�u�}�/{�s��ё���vk֌1�ʋ���t��x>�v����a�1e���aa��ͷ����β��guc�Ԩ������n>�ҍ<նp�����@���|#�r���k4��f��g���ds.�x��l0s����m.�0 ��/��` 0�% ��l����֒4��� �x�anb��h�.ogj��ʼfe�z}a* ?��˃�f3��30�j8%3�̟���&'�#{�w�&�c��,�ll�b&na��߀��v �_y��j ע���xj(i�dɞ�ï$hs�!��˟^���,������0�q��u�� �$�r%t������߼�k�׏����_�*|�]����� �b�~�ȋ�c�uڊ��j�a�o�y� ����]����ze��ej�h����ڼj��t�vq�5��8��6��k(��a���e܀"����p���xe�ƨj~���j��s�eݬ� �0b�?��{�aғ�� �y;�i�* ��x���x�vy��u����3�����4�"�'�tou�i�h�u���w3���"�&q�xj�ա����n�ws|!ۓ��ţ.kro�lvf���be�r/�5���m/q<�xtl�w&��o��n�r�� f�����&�`c�h���n����%���-w�`>����}���maivl���|x����c�v-ق �fu-���'$"���3,���κ�wa�s�qq��w�l����ǐ��ɷ[@�6�6kb�b��îf �oٿg��q�g_}�]4e���b��n���x���x�w����ѓ���wh��5v>e���2ʻ j��5�ŕov�y�ذ��x�a�/@��ј��"����(���h�\3w'q�fijj�&������)��c �n�,>�cx$�6!8i�݆�o�ې���[:���[n���|oȕ�>�����\���oa5�����������ljfj�6��g̉�ψ���d ��j�}@piq( p0��"��7�&����h ڛ�z�=�����"�%ā~��=_0og�bo�o��m$�/�p�xq|��0�9�dd���wnd�m&�ω��?�g��\�otb�oܠ�'e4:nŠ�ej}��! �o8�"z�@���q'n.�e�b�#�x�mg׎=c��� ��p���r��x�@a� (ŏq~0[���xl� � n~��;�u�6��d�)po�߹�'��a~��# a�{���w�z�v��k �5#���p{�q����j���#�.zu���w$j̴2��z���9tggxx����>%�����g/�ቪ�l�����mqf:�uţ}��m�v��u �7���6�6*na�$��s��mm���)[��y�b�{�!r�x�����-e>��…�i|qw����n�kf���a� ?o���5��["�e*=hts:ӆk�渰�9��yhf&)q����x`6wfm�����8��p w"��im׽������%]˥/�h�f��f�������t��,j� �d�ͫnw�s~��x�{q���s#o��o�mw؄=�:s� \��$��b�/��^ ���� ��g�<�?r�mvu/(������g#�.��c��\�^�[v�@v�����wo�=�� �ùc�����r�aqp0�ͥ���dk=�?�����h���$�-os=�z�� /�hy14�0�� 8�f����!���l�\��gś�0�f�?(�������ka��x��<���m�v�����ɗ攻�j��w�������� �,[(j�d�˜ҝ#�l ë�p��l_���r]&&�l����y��] �o s���e|�&kf�(j�bm�7gl� &�| g������cnz���g,�����e�9�����e5���k8[y�����st�� ��ï�2�w�~�ܴajz[��0j"�7~t�\<. ��ʛ�f��d� ��jhy��/�h�ȸ��`�h�/�z̮0�qt�����3�%�����s����a9yn1${ni�ln�%�;w���u��g�e�#r�h͂z����q�o�b�p�n�[ &3�d6�(��pڨ�h���n�tم��>ѥ�5��a�����89��8x��(��vgє[�z��g$��a �̺⍹��c(�-� �b ����umbk��96��u!^��]��~]ސ��ؓ_2�p�~�"�/cܸ�� ���~�!;eo�tm� �ddϫ�]����h��v``���z� �0����&�|i�d�q��?3�;��9�q�3w�5�!��|��c�:f�-�-n�q$"?�'� !��u�b�;��bg������o_)��s��#ո��z�9?�k��jgi��m������u��,�c� �\k�8�ok�x���հ�_<���2ae~m*� �5�:���*��q�m<�/3[>�iqf1���o��x۷�ֵ��8�ަ��j�������u��ͳ��b\�gp���e��ۄ�s���ϙ�������]��7[���3!���y���i��^#�� o�t] ��zb���l�� ���!e�g�[ ��'�am��4l��z�r�ʙme?��u��>y���|b�(bd�]���xjr��v�w�i0�pŸ#��$[� y޳[����zה�*qc�r 2�a�8z�-� ��k��* 8����b�>/��"bxgt���!i-�:�q�ԍ����k��f�ܡ(m�4l����f4x^g��2^ �y��%�#կ��cfo2 �[��\m����o �w������#,��@ȝ���ro:���tm������i�>�k'�t�b�&�}�ߦ�u"� �n���e�=��8�ձu��o��ߘͥ�n����<�,��n�|gu�!^-�3v�.��dg�ѯ0�e=�ⱦ!q�d-�ʁ��m-%�� y�[�#�a� ���o9��h��6o�6!hl樃�bŽ_,�}ǹ�|^;���:�j��"o��}=�'k���"m@(��o��s�|�n�\�ii �h|�o�3�Ԥ��o�m-!)��'�hp���wʫ��&|`���]g|�ÿ��tr��ntl��2�^*k5�� ��r߼���p� 0r �� �h:b~&����d�y��� -��c�b~��_�5ޕ�!��q]h �fn����aǀ�6�zk���nqb���2��ze��� �ags�@����9/ �o!lq h�>@��5�����'�gě��_s<�id����[�:m���4��!����ώ�v.8β��h]��\k}^�j�����9]f-�ݫvf��y^�<����b�q8�v�i�#5�#3�tfln���n e)�z���΂3o��h] b<�r��y�;�%n���:%r��m�/w�q.�o��ci�qm��% �n����<����ǔ�(�� �(�3ee�x�zv�e3 �ֵ�� �$b�ք@,%������ŋ���\:[��#��s6� /�n�'q|�#����9>��?x��ୈ���sǚ y8�?�����kk�-����pw���w��ՠ����*�r5� �p�т������ cօ�t68�r�'�<�p���)����ƾ�'璑❤.�7ot�o6����b7�iy�kza�/��q�i� wk��e�λvh b�j��j_�m�@�����w9�z�l��i$�3i'pi�z�x�#)�\�g �b�!�iǐ�&�|�2��h/������j� �����m�~&.#���q~�wf[�n�d�e��7z�gv��_����1�r]l�xq �p��[��. �s�t8�v�e��yί ��o�������z~e^���}�cnw��o�.c g�>m�a��y�|��k�al��b��wǘo"�� ������9�Ϳ�ƙ��:���d8�shf(�! �r��z����%�b:x2�"5j4r�ܡx��|dz}�2�@�]�၊cghv����u3}��u9�zp�u��sq�ŋ�}pff��|m-���ǫ`#�b�*��f�m:����m��ƌ� *��h���s9��!2�� z���с&e��f�\�6|�ț�ؒ���m��̤0u�r��i�l��k'����v]��ox|�~�e{y� v7�4�`��(�9���&lj�j�n�'qz���rs�hg��z :�-�����,2���"�[� n��j�`�kyrq c|r�5�7�k����l�82�]����?=zyc�2�)�m��5����vw��r��ߎ�2�mr��e�d3y'��lt�ևɠq��\#����x��;��"�>�b��#�ςiha���������b��]\���x��̽{�g�`��\m�r�b{�њ�4��&i/� (��\�k@��e ^��r�1�6���@�lh���ڙ�x��wp��y�l�v��s���).ꦆ큎�ڮ}�?��yb�v��g���n�i�l)�6=y�`cw�غ>=;͓uy�r4 ����}���دtog��2���_�� ��w�l�d^�%����b- ��fd�ɽl?�f�y��9%) `��/xd�e�][�޶�y �� a=�>w�����v#� *ɋ���y�l�'��eو�q�i'�a�&ތr'��a�4�i�.�}"� ����vd�ίԋ��ru��.�$�$�m����fm캨���� �:��a���'�r:v��b�-%e�[mm����g�`��%�y����\�u[�����n�����ѓ?ǽ&��y�d�r}��\����4��!�����&�z�q�p��q>lc��%���i�g��� �gb�)�yz�(v�n/����?����� �s��_y�4 2^t����pe���z�\������v�� �ɇ���w/yc3��c��js=�6��.�{� �h�w>�o�ŀ�l6�\�yl!�4]�=s�ϻ@�x.��s�z"j s¤���{ ����g�\�d^�k"��u��j�^u�r����1�;�b=x��);q#u��1`��o�-�gd��3zn�;�*�ͽ|8i���]m�h������.e�2-d�μ[ʣq ���b�-a��$)r�¶�>�� __r�r��g����ـ��>�he)����,m~���ł� �w�r���pc ��s�7 sx��y� ������_�a�]���������uko�!�fi����ĝ�pl�����o�m�ו��a$�}ko�$g�����2���x&'t��my4jsۇ����a����2���0�q��撋����;�b,����z.4�@�牊(�� �͕���a�� � ����d0'�u��qy���j��c�%��y�v,�gq�42��=���$ea�м�izp-�a� ��t,�:�3��7%���~��?��������� 5�d=��q�:�-��~����� z��u�]�����v����und�=���]ȳ��>�q~�v]=�%y=������:�ftsu�z������ߞ03�_�5�;��p�cў�@2��b��]��r�en& z ��pf��[���4͙å�s��%�n zq��`'<���q�vs�x����hc��c�� c?o�{���trá(�j:�����y �u�lp���y��'?�z&r���s�5[������@\�hl��w�^h�ͻ)�8��w� ��-���cf��t���au����g��[s������(�[��yr.~ �v}���|�cp��~� ��e�y`y�/xp� a�yi��]��du~y�)���#�i��x������(ݞ�� 9�����h�d~�:���q��'���_��u� ǒ� ^����t"4g�ߖ#a�3f�76o��=�&�c��� ����3��=�"�(�"�p^f���5�}e���z=.��s<�hd?�et؇{2ifi��؅х��nkm��9�np�� �bn���1����x�(�@rn?3g�ߞ�>ь��fy��g���c�~(ik>^���o���z�ă��{���c� 8r����o����"tgl��u�a;n��uא��m�b,��c�%��=�����q�[,"5���f'�)��!@��yq|���g�2>�u6b�k~�ѥ��c�����e���(����e����>�dҁ����bbk�m!�zr �x �����v�y��c���� �.� �} ��ޗ�9�=���yf��fk�d!�ywȫ�����{�(�p��}�;ik�k�ws��(�$�\hn�a�u ��or�y�ya �wd[];�������� ��mxx�(aa*ۖe4��1�������k��ow�vc�e&��mj"�}䬳���ï�š���^_64| l{��u��a�����*�y�����lz9q��t�7�/�y����}��q�׽���iq��n��#����b���x�n���>~6 k4��m x�of�d���x�loi�q�!�i��٩cr��m5f����(c�foc� (���o�;ƈ9��n�7��%e'�úc��x���i8�®z�_&��c`(�0za��]?p��1õyb���������?~��bn�p���ǭi̪ #jz���o�=��豏����*=�lc�y)�"�e��?h�����k��o<�``�'�) ������#t�y�w4���|f�m��%ï3�&ީ�\g�/�c��m�4` �9�yf��0/^��>rvq&_�e��s庒�jz�^4��31o�7b4�?��cxrw��]<�����n�^� �\u,z���&%��u�u8<�k|<����1�i<��=�x�`w��� ҙy��t4�>}0�� �4:������4��#��s���k�@��×�@���"<����(s���ka����b�����rb��<ʘtqi t ��x��u�~,w�\�v�u�q"wn��ba9��@`cy�,�u�g����48�p�vc���� ���}ԏ(��υ=�oo�1@�*q�uv|2r�f` �:η�n�<(����ө$�2́n��i�,�� ؍��3ۻ��լ�.*w�\�j�c��b-�\���p&?����_�[���-�d�(�8�_ʘ�i�=�e��v���t:n�vpի��p\st�� b��*m۞>ȕ� ��(g��2�#6oc���7p<b���8$tg� ���l�!��og��� �#�g y)f����u�f������;�3 /= �"���x9���\��4�[//śn4�w��,҂;�'4��i�t�a����;�"%�|��j���b0gb�w�a�l���j"�h���s�s���n������_e�'��'�hp���eo��"��%^�t�f��y��6v�i�e���(�l4��a�m*�82~��ez��b}��?�-�=�r��ŭ�넷~���[�?���:c0t@�1���&@���@��w٣#��yj%��#�� �z])���)q����ȧ ��oa ��~�/u|ĝd\���=wb�w k�#�1:^��q����]wc�#�o}�*�^�w6��mh�m�������6i�6j�ړ���@���i�z�*���p�z;u��^��e� 9����2!6x��>���9$@�� �׮q[�"t���coyld��q}� �e�n�m�^e� ��8a`�p� �``�4ے�v`qn��\�d�(]lg- ݺ�2��m����?�fzg8����s���r�>��� ϕ�|�ʾ��<���w#�ѓ�9��d��h2�az�z�vbr��c=��ȱ�c.���d�l�$l�k���cf�m�r�k���tib�s��[��ԅ����1���}c�e'�,�cpd�d9�\1�os_��b|c=�6�y�p�6h���51�&���x@�h#������c�|�n��!��"�8 �������u�q�z�m�i�xu!�m�0ι�{���[gx��`qz 7:`���[�۔dc-̚jջzϳ �]6�0��hg5f�m�). ������7��v𪏇y$ �`�8��s\���������c=�c�]k1���1fѣϙ g�"�,���u0:ݵ���}��?�xʔ�`�b>�gx���gw�g����f�v�x����� ?l��kz��k�����6نȝ<$�h�$! ���u@��5������ ���`��=ff�i��z�\h�1������0����y�_lĉ�wyr�mv1'u�&���̋��m�r����gg�3���?٣r��g����?����#�r��vma�xi�����:uj;:�x�f��r ;�a�� #���w�=@�b�@���'c�h���>ihpn�k�h���mnч�n�o�p�d���*(����g�ul�>]�|���7*�����}hll>��x �\�/�'�a>���8?s�� ��c�kz�̗ȟ.�t�/^��~�?�����s�z�kh�������g�����0fs�y�%g4�,%���2��`�hk�낛e�ȷ��br&"��ɇ�h����b���}s�w �^�i�az���\u�ԕ��p�@�x�x��s�f�la������ l���t/�d��n�0�c�!�6�c.��4 �mal�d%��@��������w�����`�!v�ƨtw�0do�d�(9��kr�q:�/��i=�̑փ�v��o�|f�v˒m�rl(�zef�@s���hd"f���k��{�~���.q((xn���f�n����� <38�h l�)z� �$%&������������ʦ���,i0�ʧ�$v/2�7�g��g`�쥹z5u[-��aq�%m\�ɗz�}��b�2ær�b�e�-;���b(m��ׂ��x�k�# s!e�_fz?��ƣ�o�i�8az��3���û�6�;k��ֆ)"���o�u��bwn���k8���l7�,�\��:j��o7$���i7!�o��$hg� 1���� �dŝo�-s�x����]lj g,�,��dϝ~p����n�%y���r�������e\�b�^|݊�ns�y�huyi�#��]��ץv� ��%w�xf�m�g�y�յ�n @ט��sa��'rʉ�"�8��ml��ܧ���p��v`�ђ ?c�e��y�4|#���[i�jqz��s1�� iq�32�� �d@�qegkh��r��anɑ�e��{�߼�����g=��uto�i�i`e�^d�;�):n��� ���s}���a��m�\ħ(e�}l髜�0�e[�=��!�7k�#��@9�>�hq�\��=�0� ����n|7p�q��h>��_�s�ρš�es��*�ui�$�"no�8#��b�ep ��x1���yp���b���ei$�ؔ�x��]��������cuyh��%!/�$�w��%Ϳ�b��e��b�jن�5u}g7l8��@� p9#gk������=6f:�x^l};�q:lcw@7��y �yd���1 z��r�!cȧ��zp�a:����,�sfg��dei�b�} ��$��/�lz4�w� ��\����d�9"�����x e���`ijv���#s�����|ؙ��<�o��~�eϥ����j(kt�2'��qkx�{fs��3�{g'����ےy��z�w��x�u{�h�mͮ8���)~z�&d��oj>o@�$l^la`��k*o(�*с��x�g %�1���*,��غjnф���^����h/a��;����u��pj�� ��/����[сd���j�;���>lќ��#�a����-$9 ��ԃ]�4�m�^�i��~�p�[�$��ןn_/$ b�r~� u7 2������ �ᇑd����0Ԧφ6���4�(�r]7%\ �\���?`"*tg�[le"���` ۂ@�??|���!$�!p��0�rv��������bk?�퓥��!':��{��^y�����3�x��s��\�a>^��^j!-��rf ����&����׭���k�l��7y1n��{5*�!΅1��yxr�.e�o��-��/��%=��d�[�u��s��m��󺜁����l�n,zb������-^�̔�d��f�6�����g��/����*m.r��h��3l&gg�t�c6��l�&��o����z��a"5�rah�kҧ��в���|�υk�gc ������8un~��9���-?�;�.zm�ə�<�k���j#l;�"�n~��a!;ao������['}\|�p�v�xrj32�@8ɝ�>�� �u�#���m����e� �$������� �i�*um�7t~q��&��*9�$��b���ui�qj�yn�w���tҫ~�-����z����^w�o����̠�ě�}%e�d_%>jo��t�������fsl̑ ڌ ���>���w���� ��es,��fߒ-��i���i*�� l�(2~�~n��ȗ[� e�hn1���#c����r�!_��󒬹����^�=��0�u��i�e�y�r-������՗j��c��u��v��ü�׾defmn��%� _���_q�/�����f���������y�\�x�tdwg�қy��ѩ4�1�� �z���2���a ���9 �l�_� ���� ��g�g��-r/s#�/>��~ey�v��8���\�\��1���&�s5 j?�tj�ap������jbjf�0�!���qvj*�}�� 2� ڐts��x����a�9�s�ym�'a�%srڡ%g��q#o�������ŏ�q�v/��p���|���ӓ[5�t��u7 ���ҫ�>у�- h���^�ҁ ���l���(~�(|�� 2� cz���8?��*l�����nx��5�pj�� ����ц?�� 6�xj0��{��x�f�ow�dҭ�^or��m���nl6�8�����[���������^6���g˟�0�,�����ŋ�dl���f�=�x3l�y��>��_�xs�2��-��0�dǧhl��^�<����f� �x 5��kr>�xv�3���h�b!�d ��z˦щ��"�ni��x���*|������[a� �u��u����r�.e��*��e�t����t�����*v��ʾ:gw4�ģ��, �v/�������$$nr�4s�-����$�m� `@x�ӻ�w����t��#��������ծ�x3��-��g�2c�nl�ҳ֓b����ue�w�"���/}������l]k�] �;q)������=_gt�b����n��\�tt���/l۞����t_y���mi]/�#�ksgw[��t _ ].$s�,�kg �ma�&� c��|�j�a/74�ݡc`�� `�>'�kw�<���l� �˦��̠�2a��o�l)h\ /���8ž�e�)��u�������6[� x�� �-z�����6�9lk�-ɉ�~���"����o׎ �nq���n���w���rݱ�e5p����d��hu��u�>trig��˓�����?�?�ԛx~8�2:��ٸt���"�k�b"f�<6<���n���"�y[-�z��k�n���#.d 9٘��̒����3�-�̞��c�r���&}$h�w�e��)��x�f�hi�d�r�}`���3'(�<;�9��z<�6�@b�ͷ�۱�=m\��.r�ov������y�n`21�'h�&�v � ��θl�#� �d�l����y{�#`o\�| �:3dl���`��d�=k�q����\�-�h�,!�pml`j������<3,�=����� w1�ԙ�<���?d���iķ'5�zq�\�!�z��fr���@�����sxt�>s�vlu� %4/\���a�v�"j�o�ьtfp(heb�.>j�y�g�lq�edrg����^*r` �yk�ƣ�ezqx/�w,�c>re �����cl���}�'`�ˆt�{a����4�c�"���]^ qd���d�q2�un �f� ޓ<)o]�b1�m�����]��~mo�?br�x5s)3g� �� �l�x z��a v���fo l ��d=��8�gk�w� �l0�^������n�߀b)��9�&��������~h��vj��i��mg���ۣ�0g?�e� ñ��-��p�p�c{k��b�_�<8���i��*�x��ī����jŏԅ�&m�5�ws�9�,u7�*ŝ��uq�)�؈ц'��w���q��cx�;v�wg��j�ċ�d[�\��� 6cc��a�� ���e��d���~͇^.�w7'��i������2x.�ͨa����z2��w�^�c���n��ϱ[��u�k>����'g �!�5���v1�m:�g��]�y�f�:x�nq85�;.�t�]�߸���<��6<y�9�a�@�=fxz�v�m':nxw�9�,�-��{�'�[yf�1�x�?�fk({����m6i{͈^�cb���8�la�jz�y���u�fo�}�6��p�y���}�b"����n��l!b2����q ��*�(�}p"%��l0��g�d� '���į�xjxt��j��ޤ�����/�d h�ȱ��#ye��1f j��������7�dc��8l�dz<�f8����]d�g,�u ͤ}��ap| fsr ��6� ���3y����.��z�f(#ҽm�7�����p��a��{.4�o�u��s�o�m������l�j(/z҉^v�����6�-�*t~��n�ѫ� hqlu�zu��dr�` � ��%:�炍 ���y�wi�_�s�ng_���o��������g9�w�]w���0�f!jc�_�h-�ћʘ�ũ-f]�l�2�!�!u7��ڼ�]�s۲n/x��n��ν:�n�_j`�|n]������i�m�e���q�4�`�9��4���v�����j�l㦽�r�({���by����_���q]���ୖ#�r�h�w�ңx�pi���jt.��n v���\ �� r���qmz�c����{1��l�7 dt���>�n�`f{�b����j8-�� _�c����)�4g�k�'�yr}?ӯ�� �>��p�d���e6#ِhx�i 8�^,j�q����x/�h��2�i��uq� r�e��� �� ��7��g��{�~}@��p�*ʲ�:��k5���& n2alhs�����xlñ�*n���ߵ��j���͋��p��mbnl�j�s���t<�dt�d� ;|�zϡn�a<$�^���/�^�ɨ��qu��%�\l�3�*i�����$-,%.ӷ���l�$�#ޭn)��6l���^ԟ4�m6�e1[b�|�  �hi��=ь�(y�����{lײ\�ʳ{׹��j7/,e�hpz h���syou��f�q��!�dž���o��ğ,9b8g�m1� �p�$c:�\]�ї珀�m�� k�8$�i���c a��y_bhz��kt�=�;r��'g����h$�"�c� *�:�-{@����58=�n���8 �ljػwֆoxixee2e�yh%pe�fc��o����vr����5h� tэ�l(�8h<�x ��o'���l�� :�#�zr�^�. {b��ծ�[b���y�d�p. e>ta����`�ߐ�) �԰�ykj�y?�yjm�a�]䞨�&�x=�0iteq;���?���b��r��a���hh�^��_.�b��s���1 q�p.p�v���h>�'�q�t��tq\l��{�!�}��v� �8� p��!)o.�1xyr������>~=l�\::�o�nqw��-ik�����q[t�����l ή�izlb[�ct�]u�&�;ވh�ec�i����ei�#<ݹ�y~���(שpw���!a�[m�� g��<0xiv��m�����p_j����/��*hݼ�dd_?��h�o��t�^rv�y}��f�^�����#���sj�y�|7��fq�e���y�[�;�a���=��"lwf����bx]����?s�s�8;t���7�o��$ ��⇃�o�6�xąa�d�t�e�1�.���'����3mκ�gq;��l��ܥ��`l����c���9@�.q^�?n~�c?��������iq(�j%�u�y!��l�$�σd�zj�`���p>>�?ھq��>d�>�3wi��/m� ��"�d��������f� ��ܓ42x�g���oq�fg{�b �e�~��o�'��8� fn_��&���m���.rm֊� &qc��h�-ߩ�$�{�� ����>~r�%x�t; ��n�gj��j�j6�:�5�>� �t��0g���7$l�u@�ӊ����q�jv�r�<�'�a���)���[����ۺ�ٍ0v��q{<�k�dr��5l4o!s5�f��[e�1����=��ӆ���|�alg?d'lp� ���nj ����/g��0.d��ӯjt҅�:� 6w�� ��i���dro�s�1��u�ny�j�6��h d��06�;m��ͱ![0���zy��cup�b��ꈦ���ml,����pu5*�x?u�9��*���#���,�< y4�.�v�z� �.d�z3��`ícgi̞�����fs�7j@t%9'����`��/���qn�rt{$3ë �"�%m#��qo��3� i�)#v�y}��)�-r%viv}�#�y���l� ӄ��)�bh�bi�yy�1p ��a q�,-�(��tf�"� z�`f�\�`�ĕ���v�v�*g"a�x]8}���j�.���[z7b����\�ʢݺ꾵um��[t������i`��r�?����>r͸�cm�̖a�r�[���&��a��:a�&���ڊr��^���� �##�>��p[���įr��{���yto ��-vq�f����ݪtn̤de�ܚ�=�̡�� ���f��\b}i�`�t(~��d�os��}o{)��dy�"�ٛ sf2���o��x�?s3f]yϻ.�8y��#q�eh��)���d�~=�b�r��p�g�z��vhe�$�{�k&jy��]z�#;�n��mmjw<ћk �==�u1_u�gd�~��c��l���� %�7u��(�ڈ��� �] ���&ya%� ���qύ�qޘ~��j�/���q��ݮ���4�f� 0(r�p�� o~����)34� *y��]�� �c��q���q��l x5v��=��&qm�����g�v�lq����?%�ft]����k�@a�n� .w5���?��z u۠܅��pd�:u��l� ᛚ�_x�� �b�@u�j#&&���a6)n;�c/��o��ԏ��1��m�` ���t��'odvq�\�j��~7c�����=�m��6��%����(<[��(>����q�}p&�uo�'8d�t�"���m���ы�����lb�'��g��}���%q��c�-&�xp4�����uz���:��o���ǯ�1�m��ħ���<}i��ic��/��ݛ1�j3������lj03�s��=��e3 �����#�k��s�64��}�[ց�����w�h��8���z��dx�itђbjfp�awɸ��u�$�@/-���e�)a_g`q�r/�[��;��p��. .���j�|hm�n���� ܿgh�=j�1l��=n�*�v�˼x{�c�mqк1-��� ��䪖�蛥qn��׹ s%�mt���7fo�n&�ty1����o&qk���s�;�.�,���6c���s|�rb�����uh��q����(�� ǖ��x���-���< ?��|�8�q{�1�p(�n��-��n� n m�z�5�b4a�|���=6ps� ?����m`v��mbl؄ly|�����4⥊ �u��x�q� f��b� ��sx[��a��f������"��y��;��(�[�<>}��m�~%�����5�68��v�a��sp�w�1�fq��9��ed��-��s���&�c���u��1��5p(bõr4�ʇ��g�j܁����i�ks�����ĺ���o�.�m�'m���q ].����n/zrc�2��}��ԁy"�8} �k{���/��"y�|�z��(ǫx�b^i$�1�����w%���î�=j���f�t*^k�mlh��,k���c���wzm<{/(q��hp%���8���e����<�cr"����d�1e.r�\�z�i�lˁq�l���tv�k��� �z�)�j�h���w�o,�����ݬj� �ڷ��x�z��l�a��avq=w �#��� �w� �,���(� �&�o/dd4kd�f�y�~��o��oe���g�]��f���mv��w��ڨ,iu�;ͽ�>�ԃ��fr��͕� $�q&��@&�z�������$kʈfzd"�=������t�����t�[�9�z�=�d��ԍ��v��b�z��e#*"9c����sban���۝_3|b,���'�)tw[�]�����p������]��q@�벻�:�z}��n��_��-�|��|r��y�������9���[l-���ca�&�~��<����h[�= ~=cq�ױen�k���@zmbe�p݂2��rj8�9$�� 4���g†!�麌7j��`s�.�c�=n�'�t� �p�� !�i�1��$���(���!�͘{r;��!3�{����y���7�ƹ�l�"ٶ�m,rђ��թaewqg6m�!���zu�q� ���&����>;���'|�?����&�ӗ|�q ����hi�a3;��t5�i�s� f7w��q��5�&a�aӄj�vڗ��$3�s�a�<÷fa��m6˚��:�y��gmm:�z� ��� pԇ�����ml�8�oԙ�uů�r��ae���j�ԋ=qof���5�����bd�t���0� x�;fpp� �"1�lj"��2֮�>ҵur=��u/źnz���?��.����f �q����[�i����6���3kҟ�}n'g-lj��^��o�ju��quw.��z���]�;�ͥ3>�m��8����q�~o�g���k�?�c�d{`oc�a��7��b5�ń�m@r;�:^��y[ͽhgc(�i� ��ϋ��ǥ@ٮ'=�h2x��(��` 6��]')*δ��������97�v҈ԉt,�д�j�yt"�n��� ���!�ⵔd.���式h���t\oc�q-mcm�[}�j�'��፝ol6��\2���ilv2���e�?�ĕ��؈����@����=�d��n��4�ȅ���kt�{����"1�qlye�a|��u�& �� �#���[&vd;����-d��c����mpq� 9ѹ�bpog�{r��g&�ӝ۔uf3�k;�k���?�{&�$�}s�t��2�e�h�{��ȣpdæ8��]��l���8��ġ b,ҫ@��6�2r�i��ay� �� �ӟu����trl� �)0 ;j�9b��յ7�8plf��� u�3 z�1�>y*��##-��#�ѣ��bcu:l��� � �)�.$�7� c,��a�(��hk�������hg�u�?h&�ʗ;z���0k; <�'�vf��,�hb��08�f��겛�n u,e䬫9��\�;l�idn�w��w$o�rv��/{��d���m�fq�i�ь�1�5�d���>��� "|e��:��2 :������:}�&�]~? �`��p􉝓i����$�kx ���� 5qq�̐�l>j#�n�&'��^k��t�y�@�6�߅^� k�k��\\���i���ϟ�y�*�5ݔ)�\�.a� ��ԟң�]�&v������xr������kq�?{qwm�t��i�gh�wjc pd�z]� k���lӄs�`u��g�f�epl��o�=bbq��#ew�u%[e�m/sr��ӻ��[�h�e6z�߷�:����w�(��6 jr��~膫3�����x��7���w�0$z�:�t�2}' y��j����˯���"��d5rz���ǟ)%&$yyi̾�棍��������lu2ѧ�u�*8�v�j��d��bg e�bq�j����m�)&�;; ���@����$,b�f����܁m���<(�9���y�p�]%�����f�%�vs�m'�^�ed�>��p�"53�kxof�/9v��^�h3��j�iܜe|'6[���u��l����5���xv�/<��n\�3$�`e�by��.�7�s�w�x��]ch����j�cb��@��/��`?���tb���n6{�����$e�u�����=�jj�.�xd��$e�`���֝:���]�e�1=���,�i�i��s�/0k�i횆�tc9:k���x��!�f�awm9�o;���l��s�ܤ��:a�j���ˋvz|:��ҽ_p^�-h���:��z��� ��b hze`����mxj~���shh�4���s�|�׉a)8��w�/�� �g��=o�k�j�p�f�x5j�6%v�_�z�u��*1�b�ш�ŭsn(/z�8�epwb �� !��w8�i�����3m��a�ha`���w�� h:�:�;#���!��o���>p=�na�bmd�6��^7/r#��� ����6����b]��90��(�9$e��aۼ����nubc0u�b�=��x��r�t�cp ��a�ċ�榝����r�&���0�%�9�ܐxs�����<w�qk@% lu�b�� ����? b�*� ��khx��q 2�fga|4* n���8���͙�{�%�1��a��% �c��o�6n�zc|�b"c4� ���z k�� �yp4�e`u��~��4�� 0 ��ڄ����{�؄���\�1z�/�_ss)m����!�z.��o��i#ք��h-������[��8��ȶi�c�������r 0�9 ���ys�5�ԣ���u �ݥ��i�h��#�d�����v7����맍7 �.8w�a\ 4ߝ��x�a|���]��qe�wh��c�5�n��滆sxb�� �e�����tf���^���~���<_�󪻟,�e7}�)�xi���}�ԇ��y~�?3b&í#��e ifz��c��(h2���������7�e�a>��)?�ŏ��[��'���s���c�ysca�����_k0��dm�zc(�w����je뭚��u��6�$�l�{�������wy��g�__��և��a$������u�z�ͽ^7��v[����^�� ����j���$l��o�t�ǜ���ԅn:!��v�6�d�,���ŧ_��/?7� h0kӫ�ϝ�b�5��rgv�dqv�ڭ@w����o3�mi��b��vv�z~�s�o?(�e^���� � >e��z�  "6h0�q��@���t�ī?�7;ob]���ea��������ӂ���η��g�����c@�1p����$[c87 to?�x�ݻl����wgӭ��^ѻ���ơ���j ���?����b.��iv�s��i��h���廈�h��j�)n��)r��o����=�k���!tc��6��i�!��`� u��.��v9������r��cf i��!��oǐ(jq��q���ht�'0y�y'�vm��!s@֦� �ô����^������涛^¿�8��?%��j��ydѭ�z[� g��t��.��>h���xr=��� 7 ��2_v�\�;����p����")b/�v�v�@��  �m�h9z��i��d�k5n1s[�5'����23�zo�=0��b�d7%쓈qҳk:;�q���a����ua��<�<�d��7y��ʑ0p)�� ��dc �@f������h��z��b �0�p��$mn�t�hͯe�9��&-"p �o� ޴ŕ�hm �\լ� *ַh�5đ���eupڑm��sc�m��� ��fylߩ厤�zi�-��3�x�{�i��v�s�������y,f��r1=�q�#���x�m��]��vz� �r�!���$�ꕇqqu@l^\{t �7yb�h8��3�lz �,��=g^o!u�v���di��)� ��;b|��8��;�84�~�5���p �"�-t�p���d ����-�yûb{[) a�&atl�l]� g�&[��m��o�˫�u�_ԙpy|�����8�q�i��#-��ut�<���� ��v�,'�yc?�{c(�r�k؇�z��j�w��-ϟ�)�qr |��l�t���<�n���d���؝=9�ˢ���jpw~r���խw�/ٓˋ12m޲�tvl��x����>�� j��]��nj��!���b�p~ q~�aٮ�k��1߱]�����a����k�v����v-x�����|�����ޠ�o_���j��ً�?��l��� �>�������n켿���� ����;p�ϛ�v�� ��mp��x�����j�.^�j�����,0�<�c�[|��iy)�������^��?�~�|��y������n릧�٨�#��'s� �l�c��q@j5�%?���r[�b��)>f�����}��6��m&��ztn�q�du@� ����ͷ����7��?]e�\� _a� ��iq\�k�n-~z�� �z��#jc�����n�������o�cc"&� �a<�/ �\�oswf��p����� v&mzj9kz<ʯԙ{�{�=kh�/�2g� g�dі�� �3���n }ݕ-9����tx=�.=0t��s�p��mt jk�p���o80�s��n3�z$�_c���gaa�h�� n���l:����rr��hؼ�6���ýhz|uuy����������$��f����ۑ�z`����ock�s}�m?��]��[p�n��]����g���q1�u$;�o��w��v8�y�����^�go��ޏf��wj~� �$��v�*rӌ4�jd�������gfl����mܪ�d�=������x}1�; �c��w w�i,*nk����8�y0��(g�����aɹ9[l��7u��vv�2�"��u� �jy���̑o0o��.q�x�`�ώnq{�ߣk� n�������db�z��ԯp�{f�) w��*�����x�b��rrް1��&��v��"���x��n!#�a���#�����<������w���z�:o�u���d!�|�j�g3����id�f� r�6�a�x���`�<�@sgq8�s!���r1�t`��� ������|*۶��p szu����p���$u�� l�� �d��rh�۬�f�i����=k���8_">6t�3�� `��xb|a�g�7ƀ�w�:m\����c<ݗ�ɗ�� zc�&��������x&䗇w�^�`>�g�� w�l���(b�q��{v`��r�d�ަj �����"�ėx{<� !ުu=��cmcf0%�&5�h㔽v�v����s���p\�|�k x�u��6#�x��5,:x��3�\��7z�̚,-s!�^d��0���ޙm��-�j=�ng{!�t.�)�-��9nۛ�>����$�x�4c�.�xu-z���2n�i�f��n�ꔛ�'��ŧ��^ն��cmm�2bc ������qꥣlgwcu���9�qf�ϋc_��e�&� ��}�}�yq�/�4hl�ě_���#�_l!6�� y���a�#��mlp���\.�=�n�h^l���a xfށ[��h}���ԓ*���⢴u��%`*caܜ ��w�.����)wh{���@ei�'#[��׏od��� ����anvv8�z�|�a��h'>ў4`l�4��a�z���=f!(�h�����4�kkm)�a�t̗z�gf4�� ���x�c��u�#�*�'|օ��7�v�&� l���u��cg b켐a�֊��p����z�kxe�s��g^��>�/%�$a�_e7�νf�03��cc�x5��'��1�_�-o�d�hx n��y�(2�$�����s u�|uii̫�1���d�� xp�g���pe��1u�$s:���k�'ښ���@i"n#(mz�/ѩ��@r�l���t3�0��"i�m�����-ar�h�� �*r"nf�c�g�.��s�4n%z�*�f�9-i"�~���)u�ܽ���5<:6�0k��d,u���(�;͗h�i��?��b�8�0.�o/2����¸l������rܖv��ؿ�s�s$���� �lzub��:�/�f��3 �ɸ:,o�d�f��@��y&�7���=�i���n�v�n��(��ib���,2-�� ��� �nzu�n_⍊qwg�v7q.&��0hj�vt�����h‹���孎�c�ڗ�{�my>˿yq�<�0-1����h<�m9/���wodl9 �̩��ff�1fa�$rl�9c�f�2�؄k6�pp}���х�6lx����4�ӫ!������}x}6�z��]�t�j��sf?z�6���g/ ۦf�'���إdj\ko�����1}���_� �n:t(d9k�xqr�~$��"�w�#q�� n������u,��5����]�������*� u��qm�}���5j�t,�`�m��h�zzr��}��n���?qi� �,� � ��`8s [ -˿������l���s �fyn�]��� �z�ec�l�p>؀m��-p��# ؤo`qi�0i��z���-`a��k�__��ވ�:3b�t����hm-� ���vf�ia�q!�l�y� (�@^����y����zs.j�m������ ��i3�%:���ݥ#w�"�{ƣ�d��h�rغ�9��^|t�@f;�!��w�!�6� ���e�� v�0�w�k�벻�����:��x�^ǫ��bs�r�a@����l�fu�����gbe� �t���ը��y�~[��mw�7\2�}u�m^��j�7�lah[�gz���o�n��kw�|]� /�s��`h�e�e�t�$��_ vw�����t=���&y�li�bp����h�0���>���k�g��1u�se�l��]g���:3�g'���eai��:���`z��2�o�xhuh����%ϻlbu!�o��pkqxp�e����[( ]੥l� � �b�8�b�r���j�(��en�j.����}�g�|&9fjvs:�^�\`mqp��95j�8��%�0���z|��rdv�-��-� {k~ �7��@�gz��)b�l�x���% ��á�f�m�?j w����n���a��rc��k��������"ѫ�wz�zɣ-k��}�e� �f(n�2�z*���ku!�ܙ�uxm�jlv�r2r[��ݶׄ�i�*��t�5z��>v��ge��ҽnv�qa���hxڋj*��f2 �z��v�k�ɷ̪��kv�h�!��ͳ�ߋ��ȯ.������ad��d����ǂk�i7�h���ze�� g�6� һ ������~>i�n��'��5f��%��l~�sz�z�o���>����pk��4z� �k���7��� wz����vky�$�("�m:b������w����ѐ��6���0�6>��gt�n�u��t(�����̵^do��f�eor����=#x]��j2h=j�ԓ&� �wewc��9�ure`[�����;z�j���fⱦ��?�g���� :@�p�4u�9�1v�h����f{�9@"�y��v�:a$�*��0m����bc� `t����v�㘑be. bk�^xe��~�j�#ִ����f��s�'ј��.�ĭ��>r��s4���|���j��4���[u�ݱ�_�ui��49��xa��d�f�t���'@�@��nm�� �}[�`z�������ju�qf�憰���p���/�{w}5���v�z6}��,2n�j֦b���������?{���j\&�� � #`j\༏ *xe#�g*>�����axg�7��ԋ���n�^kwj�͊o�b�>o��=(�&g\��iǩfa��/� � άea�[����*�� ��e7� �'����v�?�r�� x�a�o� �\h � ���q���`���9�@ln# o��'܁��&�ii��k��izi|-6��w{������b�@�l�$u3_������z֮ք��d��������׾`�ky�� b�:w=^�j�v i��hy�e7��ڊ��l�(��d�uh�ްa��s�6��-��7 ��$tl��[���əbm�j�^"���[8� �r�đ5����: �:8�}�"z�=l�ȹ&i;�0��')lh� �?�(iqxj$e��ԅ�r�͜w�h��j���h�v�w��m�)!w���_�<�sk:�on�.֫��x�ؑ��1��p35��h"��~9���v�b}&ş�` � ep��8��z��l4��c��>�����l���:)l vg�y}~��c����sl�q�9@�1o9f�k��¤���x�:��]l�-:ǯ����,�j��!���d ����3'�_����4� m0��xk� � �d�|ciߢ��� qzm�����ur�� ���� �0�3� i6�����-� d�yrp<;(�j��=b�5��v�aci�t���*�x���� ���y�ƴ= co��p��ws`�z}��e������jg`���n>�,�wh�0��)^���x5�x�v�r�¾��σ�j������dp{m!�ݼ�g�p��# e�����sp�� &�s|��p��p�ѓ��a*��g1|� �q��\?�ezz�dn6��p�f������e�����k�r����\��aאk�ӱh�5�����v�w���bsy@pk�zdc�r�z*��n ��pr�����#���� w�d�]i&��gf$v��1%�m�k0h5��fډ�`:;2d�z&:a (�mfѐ��'#t���͍%��%~b?`l��p���z���w�•z�?���ę�j�e��z�(�x� 7d�e���=_�b7~�ˋ�^�z��?���o`o�%a[�/����j�z2�$� �m!�m�~��o�q(��~���^�%9��a���h�nq������d�&8�(z2z��ͤ3utp���#�fx��m ��e;� ����������iߠ� 7z���� ���.{� l�e&��t׬���'����o��ls���zi-���u��-j^�_6���m�sκ���#�}m�k�-�kғvq�jd�#��s��=��c�����;5w`� w �{�������3c^���������!�!��x�@d�{��m��@t� �zp��'�mj� �p��0pr �$�v͎��-mnn�/�`�p�:�'w��ԯ�w�j�q}�& ���l���5��c~a ��=un�{td0�< �g7#����=�)p>����;��9 �����n u�9��0ƭ�!�n�ӕ8o�|d�_�$i�?ۼ�z�ml1(u9�*�  �� ��r�z�`� �14�pk�ц�����\kl0d����3�֐�z`yj�ؓ:eެ0�� %m"@�߁��� [f{k)� ��?��0do����6ym^d)��μ�6�h} h8*%9 ��v|q��0f��ڥm9��������٧�:����y%���c��r?g;�:n���b3_�աgvl)�n)�]ckq�w3��:j� � �t���vi��5@��x��*�����tt?die{n[��'�#��v����\w�k��7�-�u%�h�-���hay\߫1�\4�m����; ʀ9%����|c��a��� ����st�����p��"8���ţ',��zu l�mc�7{�hk��sm�?u���k�]����/��ďpte��*��v���/��������&2p�"�ء�9��q�f�b� ����77j��a��/��7�pv���ri!|q/�a q�~0��@z�m�if'l��k]f5�.�pgۆ��/t�v��l�� ����j}�1��g|���#axq��(��b!�hu��mk㬽�( � �i��� i���i#{��|�i��py��%��2-��%���qed���y� .@^���(�d �@d��a���� i�3-0d ����t�l� {��!��k�*w ��\�7�s��pscq�~�v�jv2;��v<���gч�:'1\�\�f��(�٣e0j }q-��h�r����&���e8'�x� ��_���i@�v�abq�b@�*�ա�e\�`��8�n5� �ݵ!�)1��c�s�s�߻z�ks�:��i݆2�`"�l:�ó�ԏ.�f��ã����<��w(r۷l-������x\�*��Ԩbtf�4���x��cn����'pk������],^�>���p_� &�<]�ũ�� u����a�u��1q5 �5��s sc�an��u�4]����{�y }��t��#)6jwg�s#0��t�b����ϲ��-n)t��@9�)�c�f��l�����h�b�n��[[ddi0t�g]x�`�lu�x������v�,�mo�~y�x�:���ו�,�k7�a2���kmt)-)���d�?=�������j��;��"�k��n��?�gp�gk�\�;�a5�0�u�c��d�-�y2z��~���������!e�8cm~q����ά}�1�jx��.� o썵-��s�r� qoa>^�v��o�o�2�hb�т0��<��,��qގ�5$�q�wv�lqr�~z��^:��d�:э�.�h�%�u�dx2f�'���d��y�g�"?vnl�b0��t�fs�@��3�xw��t�,�1����sk .�n�j���d�'��ŝ����pe���n��*���l�� ��� qc6�|�� �y��m���-��f�[cb��_����j&x���*t����"���u����}�]��(6¹l�6�oc�`�r���h���_����o0�h6��s�t��l�*�̻��-n�vqg��g� ����g����l�2:c�s��xef�~'q9� c����<�[�[_o�ú��)�|¹n���a�¹�pyֻ�ey�� ���oᕪ^u�߀&��0� &(gx~t��h\ܔe�yn�~���f�-�,��e!��0� yg�<������y�bt ��t�����`�3��� �����!a�h 2��9��h�!p �'y%i�,�zpi����zw�_c����^���ѥq����x��΅�jll��=��j�*u ��d}��b��b86�v��x���(�z�r �)ӄ�!%%1��fj��֕�﭅��a0� 5&���� ec�n]��0����da�� w5"cet�_�u��n4���b0����~1v�܁fӈ w�rg"`8�� v�⊔�!�v�����0�v0�6>z������y�^��俆������f��zu�����o��_�u�w���9��&�q�[૗�k���ٸ������d�����kx�kh�~�i�5,���<k �����=ȧ�sk(0���l�v%\��:�^���zp�r�f����>��]�24�f�䰆x�za��z��j�ǒ{� �.fbc6}$q� ��gk��~�d���=a ��1,�b�*��]��m����i!_��r��b�•ե��(cr���� '�f���g��#�&��6�����9� ��1[����60uӡ��k�u�� m,�up���o����b��tj�\ڳ�����u>03w3���p��8� w�67�qă׽�1(�r_t褬���ym�0����ia��q= }m��`)s[�[k�pm�9a]*r� �=`�]:����n1d��p���h��zta���� �� o�1{۠�� a"���yw���a�$���d���qר���e��ޝ8[���g� nnc0��aף9{��ś��h�{j��p��& a ����f�qbs�nw���x{fwm�s5�bc��m�p��`*�8�2���ku`�-�,��͢�3�l=�΄4��vߤ�%8�i ������3�8Ԧ�v��y��qi浡k�˞��p}�|ɡ�c�fo�ڏq�ѩ�s���m�)k�sh���.�� �au��yx8��4~���r?l�_��#��q`8� ����>�͋�}�s=�14�m3n��޽�sav�yoȍ��b� ��9�k��; �;�^�u�z��� ��>���_ko@c���7��0fmw��g^i�@�6s�^�q�ՙ�up0u���ٍ�gbԋ �y��v�u� ��<�ѻ��7t���c*���t~�%��s� �����}o�i�7�.h��d�j�$����ie!��q�@�^��{��o6��w��b�c�0�t��?���‚��*0y#q�-d�t�������e�i�>���@fo�/�[��[n�tu��� (b"`b��� �_�o6ͯe�"i�{!6k��b�ebm�41���9z��l��t�j\�n�9��`o���-e��gԇ�㜈3q"~(1{|�m��a� �a�=��/2~x�!b�u�,э���zw�;�k�>u����?i1y��_�b=?'6�$p׺ �b���z���e1�t���f� �$��҈��t�v`�t(m��rr�4pv�� �q��������թq��h��cpb�#n�we-k?�l�f?�.t�� �|�� c�%b�y�p8�&7���q8��o��m��0���p�[w��#�z��� `���@@,��39(��#�50$��qq���=�e?6�d�d���n�t�wm�6����:#�b��u��~��h~�$�"���8������_���iјpu�x��*�5�:��讐��)&z�����έ/�5��:�c�m-xd͞�p��cѕ�k����h�vd���j�-�e /)�ylj�]�z��(���e7r�e2��� qt��^*q����e,�t�ä���a"0~� dm�?~#�s.�) �����[:�>��a$1�z���\ր�z�tԃ���\и���4thv��r�$yqz�id�j� :��u$j�q ���qĩ� �m�u#l=�i�^�۷ܩ"7�n��_g5�����q�< �2�t�q�r�e�hhq�$��#8ad��.�6\m[,�0�gz�;j\,w�ia�u�ߖ�h��ę$��n���[/ �p!'h�,h�_��y��!�=�c�=@�!h�m�m 9��-q:g�p��u$ <��=]����%{��y�go�[k���az��%�����j��,�kq�p�pv�flj�#k%fzr���f��t< `ia�3�a��j}=�` gu��>���0f̥ �e� }�s����@r���li?u7hw�b�x���� ` �a�֤�^�.|x<7� �ʝ���øs�h���áf��_8o�%{sȭ3 ��ew$ :���a��r2��(94�y�����6j��^�o��$�h#��!a��i|�̨2�s��*̈$�mɛ�e1�����۞�^���l�׌=�6`�ڱ[�is��qnj��. r�g ���w4�slyl_d�ldc�r �p�����8��֫r� [yc; lc�d��f�9�aƌ�ƶv|nڠ�gv.��xl��ʙy� �m�<�ޏ,&��e�"웘3�m��a��wg�'7�l�z���ǐ�do ���0��^���mge�!:�l�pb� ��&����a�(����g�́ �<8�rrj �g��8����m-0@�"1*b6*#f���b:m��ar"أ%v|/ �q�4!b�����3� /����6�qˌ��x<�"�.��w|8sh.ӳ�<��&���q�p��bn:�<�ٓ%m�ȋv:��'=r��'��t2�`a#�#�7�t�s%��\�fx���-!�圌r ���z� ula�b$���طg���㦗�ju�ë��� �lf֬f���`�r}�"� ��@�14�i�hb��� �~1���1�s �=ڳy��3{r@�#ȴyd�3ʋ���n���=��&�b��<�>{�n� 3� lj�� !���"��fapd�gp��5���%�䜍�do�@glm��׎�x1�m�5��3|�����-]� �����rķ��l�w����g2}�"vr}=p!c2���l�0�%&d���?���8��^џq���^ai�g�o��{��l����6>�j�"ht�j~���:�����!�x=nv������q�3��%�q�v�7-�zi�� s���"h�vˎ�]5b�j'�����8�� �: �gos�ԝ�v99�dtnp�x�7s����be;v�fro�ѷה��(8����m�d��;s"�o:w�9yћ1�k��_5���^ z��'ez���wh躇-���o�s�b@"!�ec�����\]��lb��e=3��zͷyt���5[���fm%q�9 }um��/r���2��l�xvhqzfs���cd̼'r4���!|��hs�w�f���>n2����yъ,x@��$#�h!�e'6lm��j[�e���.b�b�� m��g�5*���pm����1�ycio��,�-�#�qm���y��c��,w�v �á�e�@mπ���ӈv��ic��io7�t��g<�n#��l�^tsvoe��g�e/ǣ�_��%e��nl"7y��s����'�����n�&�? ��s($���8j��}�� ��#v ugrt����8q`w�5vw���:oce��`��mid-ͧ�~z���ع��9����~l�ڹ�]�-�o���q)!b֗���/�l��!j{��)�p�} �a;[1�fn���(zȭa�7��j�{6�n���i��ƾ���`�5��v���b1ymٷ#�4hn�m��3�ȩs�!�*�#w��wi:���9y���?!�=h�9��kf�x��c.7؟����~�*�s�]8�� �z�n(괵�c->�gұ{t{��id���!�(�t����8�c�σt�ba��h���n�$�ۏi��4����� �@�-n�k�-�s�;@���͢%bɰ)��#'.\r���o`�����ݛ�g� �xi����0%-��gmr$�gz��2�j��)��l�'�$r�����m@���ы���x�y�ǣy�p*��@4k���qh��ol���ĩ��d3j�m��=��u�m;�r�i��mfhcdk�8o���s��[�_�e -�!�����!�rӹ����nj�����usd�>�m���a�g2��7|=4ƒ;�އ��kq �6z�q��/���\�c� ��,�k�al�h���adq�-��w��g��;����m�d�(��x�5~��~p�z�`z1�qt�����4v^=��!r��z��=�ա��p�x3�s �5~�q� b���bn�1��<��u���÷9njw"�m���nj�im]�a��^�5��y�͗^n �5�na�(r�.�|w [��vo�� ���g���ѓ���{�r'ͱsн�.m7��۸9"��ט"y�����w�#���w֫7$ެwn6�/]c�ad\qw�i�um�?�rh��'��y!�r�9�3�@�g,��>9��=�r��`?� p�� ƶ9�{ �g���w)b��bt;r�0� ��g�yp�ap�a�ly�^m{�>lu>h�d�<9xu�t����mar3���� �p v� ���8^�x!$zi�&`���q���ڛ� 4`q>�b�]��s' i/��ͣh��6gt�ۚ�)�w9� � *��d�fh{�v�������#r��]�n�<�af�wd�0t�!��jw����zse�]���f%�����v�*ѡ.��\@�m�:�z[�ݱܯxp?� �b�ϩ'���>��x�g��w�f��pxn�vv�:�0������8/̆~[.��l��s���ה����l��|�l���,���ڠ%e�h�r���8s�zb����tl0%��_a�amx�]5�ײ\g�$v%��=�e,��v6,�)d��b�3ƒ�(l�vf5��l,��d<2���.���r*ٕ/&4�\���rt��y��5��f� �i@'��j�c2x���v�z��(��� �l�.�45��3h�r���3�ric�/˵�n���~ ɩ�۔��j ,^��؇�j��gօh��(6?���zcf�o�w��/��^���t[ݜ�}0�- b���������dm��'�ki�� q����zh�t '@sk�7�pm�ʳ���9t����e�fߚ�}��t �s[�&õ�-.��z��=q������>�ڲ�&� �]��3�t�j�h����g׸���m�wʯ1�p�y���-*�e|�e��)w`���b8�{2d�u$��[/�� xi�#�����esp��s��|ݩ��ega|�ӱ��c�ث��yl�#x�n�~���/�?@��n�u�w�/6��d�6�r��&�prt\�j� d�� �vt �p��cijfp���q�œ��:��տ%�/����?���mwv:�:$?����j`��-&�����8��rf���e�pd^v��g���s�o���i�k�"gv��^�����e�sybpo�8�g=�(�}���ډ��k-k�hsd|z*[� h� ʳl�ќ�d�hc��1(x�fh,ů.�a��k� � d�,)�x�m��djy���ٯ����=��l�=ˎ�@1�)��7 к,��gf?��p%6&ץj��&�a��5���v űz0�r)��k�qn���� �;����qrt�%����3�r�ᔝ<=�e�h��f�[���u���ÿr� �¦���|p�� �ha����i�����%� �j�պ���֦���n ��������.�j!i��r�й���, ���,f��'�a6�� l�ir�hu)݉8���ombiwr�;��z�_ǚdôc��{�˳/9�u�-�ԝcg��me���e�iĕd�r�s%��fw���� 7w[c�`�8�y6��z�dp飤��եt� ���c�z4|��~�7�/:��ڿn�y��)�/��$w���@��� 17�~dm�����>�)����<�t�v��^��װ�[m���.c�� g�m���hdg�!��>��ٜ�y�eg2�qd5qa�]/���!����%��hض@횈�cⱦը�� �����z>����fӏ攔m� ��@�fz #�'h�l%��y�p��z�c��\xl �=�tr��>x`����z�&��8�z��%��:�.f���l��;��-mkά��4�r;f����_���#�%�c{єm�g���i����0��g��9v jlx�^{��o�a� ����f=��v�p�x#�p��� �rj�ઌ����s��� �k�4��_�j# "t��� k6� ^��{pi$��l7�fѵ ��u�~x����3��e�$�t��|���qa.�zk���_� 3��pד�(�b�葛��r��/u�u�&�h�w�^���vc�h����d sk�m�n#�����r�4ְ� )�p=}-�n� ��k mݶ�����g�"�w�y~�4ma�!�~���w�ek 7xgx�����x�!�a2y�u g��&��d�r�u�w�8` �0��n���r����c�}��(նe>�h�� � ���hŒ����m>,'%���%a sfb���r�w������y�t)��(b�2gl}��{�h��ay��n�]�u�9>���j�[fi@v������ ��owmk8'`kc�����[� ��h!�������|�z�va���2��u���jч1���s����5������:��"�l-h�j ��c�w�64ջb ��@��'��l��k�]���,s����ާ�6���ߟ�^��{���k��,w\�ꋐ�������w�p���-�p ��<��~/�|b��u���x��׫\{v!^i�$n�����7 �5easէ�� w��s��0���i���o���1��}m���u�j>����f�̳xć(� wղ�6f�ؼy�aqq��=�����w�/8c��zfs�1����l͸]`��ؚ�����ߚ�}��=�o��3�᭡��,�7�f ��xb1�8cm��r��b<�}���خ؃��g�f�.6��� z��è�@)5�ۋg�!zԮ!j:��n�m��w��x�(�z�,�9? �q�`4�,n�z�ە�����m�!�<��#�a�5;���2���t/�?ob�� ���fg�i q�ߘ�)gƿb/*[��c�9���e�#s�k0n ��z�^��� ��z���ǵ�6р��h�i�"�q����h2"�0n�9 p7uyw�.��-�ׯ�0*.g�շak:���0����~w 㻚�n��.�.����f��!��rw4n����ǎt�iw�$��<&��� w2��pɗ.�tno �ϟ�s�vl�a�s<}#�� w���zt͞���#��&����io™�� ��<8��lo�� -�������l����w���y ,x}��r}�@���kp�`�*�s��ĉ����t����� ����|^�=�f�ua䐉ր��zv��9l�r������x������!`gr��2���}��e�o9}�ρ\q�4ѧ�hi� eta�����}�.� �[�т=yt�sm�>�����z%8�# � � �1�u�f�t�6�ji�k�� a�`(2^"�2ax��x�/���_���:o3��%xx7or�|�� ���?adtu��"��׹j����б�1��b���?��s\��m�v�x6s���n�eס�n��l$�t����tu��֊��ڏծ���:�ov� *��ߜj��6�o8��w��2_�š�!b�cŷ��%h� ��w�=xmѣϻ\ b fn1b����=� bw�jcgq����\,gƴ������>z��� ���lćq i>����u#��'�no���. h��4����8����}v��y4ku�vi}fy�]������v�w�p����@��z�d��rg)�/0����q�����c��a� ���ć����ܠ�a��,��x}h�����mt��h�`��c��i7:r����ԋg�n��fb�(ڋ2�=(c����n8|���!�r���c`4e�pj.��94�i�q��b���.\�t��̀غ���g���'�_��g=l� ��ܣ�nټz�t���p�v�nv{4��d-�����v5� �8�bl�&�$�gusb��t7(��)y�odb�����qz�n^h�ժ�o���3��팈�׃v�qt'oi��h� �ϩ���� ��ą���ԁ�;�e-k��{��j9td�y)]��jd�p[5�n��1n��a�;!`s�(�8}�����f�\��v �kk�4(蚎�oq��0�7o>�z:��nf_>�&����o��/a�#���"2yljji�]ib�d^o}��ay�p��&k|��"-���j����k���pg�ɣ{?�m`�vh���ǜ���ng�lv���=�`l8�qn���j�a��b�vо\� 'w��ȇ���tx�4@�l����h��y�!*�kl(;�4#re������vtk�g��%��x��{� ���n�-���'��m��grx��ȯ�1%��zhx)�r ,}�� �@�����u0 gi��0`&z{��1h��%tj�h#���ڤ��`���<�� ���*�e[��u�b����fnԡ�x���9]�ó���z �ۚ7ax2��w������zy�wew�6�j6 ��s r.� �\r)_���k�b a�a��}�o��٬�拕 �ht��]x%�ж�m��6���a��t༩%�i�b� � �pmw!��|g�/�������uwnx���'o�xp�����x���~s�e9���rbt9�>su��'rы�c������ч�f�&�dtx}�a�|��--sn jcm����ǹl�exn~p~���gok4[4�2���?`���i\ua��� v_ߪ� ���=̀1�]f����z5q���8��� i���j�xus�kl�i�a�)�o�}9 ����2�z ����iz�����b������0\ᄏ��%��){��$a^۳&�ixu.��&�o-�v[��'�؃���*0�� �� 5ĉjh0�jz�\���u6��l�w�� g�2��xpj�〭�ͯdqa�r�v�v� y�� ���v�qjq��똱jn������rsӣ���m�r]�&�n�[���\����c0-������pe �u] � bfq��k��]f����.@�ڱ�>t!xmy�#��e x� ��p�� �i!r�s?2�=t%b_��ht���`�Ꮕe4�p�|�./�q�p(��uy�����0��//~z�����o?�4h�r�dg� ��hd�xbff,h&y�¹�o�.�줫�#��sv�~�v����e�gʪ� �v�/��ld�p��rz��s�b�pf-�[8m�zy�*6���v�o���v1�/�:/� ��4u;<���;�q�嘕��1�����~q&� �����)�{dc�w��� ��,� ���g?� �� ���#t���}���]���z�x� ���� �1ʺ@��js�f��j�to�����l�!�q$ e��f��i�c�ͽ�o3x���|���b�8�e�|�oط��e ���.ek����r�6,�`����v�3g�5��(�� ���j���9e��p'�:��^��x��^qt �w�u��3�)��ߊ-)����\)��b.x���!��i�opp���zr�w��b�m��rl��_0n�${���({�~cv����tѳq�#� -h�°�i~�����$ /m�ʣt�3����'��!n}b�xi��͚��=r��7 " �ǻz�u�y�ё��΍�t� c����]� ,ƈ*&=�w�����ue� q@ q`���}y�����w�����j{ ����ha�����>��ą�h��v��h-��d�|�)5�wm������ȏ�]ܒ�a�ý���"u���5 @�q��"\g��ѿ��� ��opw�o�6� �'̎g۠��.dwǻ��$�r��$�[5�w�_��gmܿ�v9���f����"�.y���}�]���v�k�h$� c|<����%р��o�füqee�����\�[f��}� ��> b�5�)x�t[-:7��> "n��������^��� �;=}���l�����,�g�ψ(i���� v��k���h���z�c&b��y��e�2%x��hr��.��n�� ��@}�:b!��.�ک4m_u������j����vb�7�� $=�q���s����&, @q=��s��6��t�����>��� s��l���h�pn6�i�c6�y�a���c� �딉�����hl%ur^t�l]�;][�n'95$�:�u�ci��`ijw"��4�% �~�p�[a ~#!v�;]e �z��d�1�q� 5��dc"��;� ����z�������/?���a�x({���� ���8r d�k��ݓ���!a(}���e���.锃���<����=�� �@��a��o7x�򿿍��x�c��o��r�a�z�r��~-7���d�:h�zl-z�� ka��0ɠ��}��s����\txju����ǐ��w� t��ڹ��hk�f�k� �������8� d~�d��:,�����;y����ڴa�t��ifs��`b�� �3=��ܮ�^�^�c��|��[[@�b2��fs��() s�����gk���^�}[�wp���v3ǡ��`#o�j`x��h������p��� t́s��ٱ���pe֧�&�wxo .ju��t��g�g�vm�;�����vѹz��-tw���?dh�o� �c������n��ݧ�z�56¦ܪc��o�'(�]g���o�f~�w�׍�x����z7��:��w\t��j9���g�wdk^7e4�i���5մ���l�h߆hb�q�3��滒��"wb, �|$xipb���h�f� ^��`-�1�q@g�k���� �l�ezց���� �~y�r��}�a��:����m!����|��ߨ�ϊ�w�~d#�*vs��pc�=�ժ��?3 6w'��o��x ښm2.�;z{���o�xe�-zj8�.9�}b���>���wr���ep$���ш�p�vg�b��o�:=���n3m�x�����g z��մ�8���z���e��rkۯ�z�����g$cb����5r���\$�3z�,^�|�� �������ߎ�ړ0kc���=i�ff��-vo2��"���=k���p�^�� �p6�g�爳k?�>���-nm��0e����q���e�z���kf.j=�k2,ٯ =w*ܛ�e��sa��� ɉ����� 0�g�s��i�{h��\w�������<���?�y>6o���j�b��hs����8m��=�]s��3�����ܹ4�@n�`����o����uc(q""�k�'d��o��*��3md�ݿ��[�| p���p��� y�� �y�g����r��~g<�*��q�#�y,���t���s�u~l۪6����(*�j�~��߄,������4ϗ�,hb%�j���>�z���0}����:��"���cw��f�:�}c/)�^��r-�j=i�pp�c8�eck�j`�찘t $c@�������l�pe���`� s-�j�ހ���#;���g���ƫ��j�@�6 �gu�&-�a��rjc�� $i�c!����ȏ�c��/ (�爏�9��2f�� �f<6p��i7����&���w�:�(�vؓ^5#�f���m:3�b���ҹ�dw@i�eڄ��fk}f�d��f��d�w� �6�v����]u}a�m�5��xj)�%*!i���k�!)e� e���j&6"l�bh,���p�0�u�'ج���g�;8�)�nn:qy�t��_@k�u;��^;)���8$����z�a�lc�ճ7����j��o0¢ ���w 1�c8���m�����7-��b� �r�ٵ&u��nmr�!e�&��؋��c���n������n��n;�jp�� �������>����z�����p� oz�h����p鈶4kki��=l�c �a�cq=�it���s�0�.�� љ�^m��ָ7�"rd�v|�pm� t�?8�����m\��lwp���=*���1��� ;��v���x3>�� xv�w!c;qh��k �n6�)����!jjyib6z rt�k���)߬��[�"u�������ț�u��7��{5� �x��а���bq����k�r�t}�r�e�ڂ�² ���m�g���^d�ě`&�$h� ������#�u��ȋb�e/����9� �y���������z��@q�f5�mn�7�l[ܣ^�#%�,���f��@f����ٻc�s�ϵ���k��t;o 2v����8�n�u������(~/�da�<���v7e{؛�v��zze���� no�b-�i�p �6��g���$$�r��i������m&��q<��x��4�jڔ�-����&`e��� ��%���k�j��6��ww�?��r�\gm$;��t)ۼ�4k���)� �8� n�˗|�o�駻� 3(ɹk����y����~z�`a�3�p�r��w�v�4v@ozw�en6�> �c8=��~���*�ԫho��ɩl�}�!�j�#�4�gэ�� ���s̪���׵ٸ�4 �fp���'�����r1}_o�/t�ai�d��j8��l��?��>�|�lظ1�pg��� ��k�mgi�������ԙ_e\i5���!�ob�vݸ���r���csv��@�b�µ|�ݿ���!d�p�ģ��a��x;���b�c3� "o:ٲ�dzja\�4>������d�^;sšz��d���䋨�i�f|�m:{�e�x�y�1i���h��с9��е�:߲����^��bh7l���b�`���ʚ���ηj��������e5mi��5h9���w��i��ܬ� hŝ�bn��sy�o���� ���m�d����q�΅j�` #se��~��^uw��oi�4�ws���e��d�j?o��r���r>�yxd"�kcfc�r�xw�����e�%���ua�����f�sf}�w��z0�����!=�h$��=�y6�u�@��4������ȅ���͕i�>��ü�6$}����-�ʶ�e�m�{k���g⊿'��gzi[z�#m��i��f�l�z"a�l^-�j�1u5ϊ�]a&8�l���8i���vz��yҷ�g��5z|��#x�)����x��g�(�w[#�r��d�c���5��?qݒ��{�6�}��-jn��c&��l�ɔlɲ�)����e�i6����e}�a3���ʭr�;yk��f��ǭ3�0e�9� "p� %nw�5zmx�o�*�kh�vph�b3̀!�bj�|���� ȅ����w)�v��&�#t��!w7^� xrx aoq8*$dn��u��h�tb�̨����*��yb�y�8�d)�wى {i�\����� ���у� 2h�r2�1�_��%�p��3�jf�� aw �"�>o���-�h~ &8v[�@�'���������9��w;:�����5v������2�o���_��4�[��-v� ���[|c-z?ҽ��������:��lods{q�����뉱r�_i��m�tqe�a�â����^ݳr��ҕ��dl� hr��on� ι����z-y;pl�"h�y�fvj�������,��a��!u$&z�􄓏�iz�j�*-�$��iw��d ���{b:甄����e�p�\��t���bykc���o��'��=�w���$ꑙ�9���$ ؤ�u���d5zn%��*} �� �v�v�~b\b2����ͥ��&y��%f�����&솆v�w:�u�d���9ʼn6��f�c7��v��5� ���m�b�vr�2��y똲�sp.njf򞮘�ky��h.x�[��^�~��*��r�z��v�g¥�$�i�/��zp����j�'d5/^wl�dj��cut��f� ���n���� ew}�t�dof�� �#�y�o�k��ul�]divg;����ޔf:�,8;���z�ur�n�d}�?�4^9�����]��m��j6]$is�j��m�����&��kl��'����j�ýy��bv��-vk:�����'s�sy �t�/�� ��t[��ɋq�ji�l����d�1�$�4��f/e�=�ɯ�"��o���a�qం����/�~��\����7gv���w0z��0w���ʑuk7jư�=�b�z�i��o����7�\\y�g���#�z����ȳ�*8�5ґ�<3�����fb��ǘ�����-�d��]/[ύ�h��g��d� ken�����9�z r��ذ2gg�"m �hfdl�_ ��$q؜�&?�-u�|t�����z�a�8cs�԰�q��r�w�z��2;�l�-�0�-���7�u�ƃd�"hb@�-�l�>����#�m�t ��ru���^m7~b8�nvm7s�r���븄��8 l7bu��7��pޒ�?}��ԙ���Ԩ�ws���}����uh�����6ws��<(�$��5�*��ₒ��i�ɺӹ"w@��g~a�mf���hilm�m�j���bw�͈f)�t��ls��#�6<�cf:ۣⰯ�0� �m� n/άs �>�@mf�m!�k�g���!� ;\o�%_����'�xd�&�m�� {�ʓ�̓��¼y%�bg��n5ӣ��-��irwi��mkez*(����fό��_p� d����2z�cj�4y��*0�k��x%^���2� q���j�r����j!���)n j �v���ma���z�-�h�*�m�ǿ�r�<���2��![;�:��1a_bp��u$�v�o��rh�ki�ְ�2"|'���8lbnr �����yj�z���,�1��}py�y;��k ������f}h�e����äk���"�7,ѥ���_�i=�1���uo>�fлj���a���"�/f� �i��d�j�x7�5��_����r��l{�:��50:j�� �m�lp"b��җ�tm���m_�r�&���t�[;8�jc��jn�`y�&��5�8� �^��^�r6� �΂�m��o*�n���#t��h���-��<]p��&* w�n�ٿ��k�di%u�gtord��^h��� d]eώ�bg%����*����$vj�$�ws�5}-h[��x,pb�� s�`���#��&=2-��l'w�\�p>5pc�����ųgh�rwj2ڸ1j����ff�ses���\b{m7p�@-�"�s�^�n>.g��h�^�rz��a]�)�ui�s��܆�c{��v���w ����}[syu��7i�ط��gwo��b-� �b�[�)m���ʐm���5#�����u��:�w!�(!i�~�4~mf���#�i�>���ŏ������bb�6��dg-0/��!a}�g�%%���p��?� �_76jd��7��q �p��;s ����i֩¤�m{��[i���h��5�\� &p*=�c���=�@$�jss�wp;ظ6�di�d���cg{je8?u�`��a=����;�%d�ir!*n9���ƛ�g��l$��~�2=:i��ff笑�υ�~o��nڦ]-��o�b������:ƙ�lk'\����-~�8�q� �ˏo��v8nr�he��iqԡ z�"z�j�ؼ-�u?�d hl�n����.�س���\8�2�x=�[.�a׊����z1qz�j�p��v���� �}%m#l��o�-g�(|��fza�����y����4/h᝸u��{��޲>uz��ffl���d4�_�b��<�nv�mo�6g왧�җm>m�l�`nt�&����bg�wٰ�1k���!����rz$g_nyv�-`'�j"�l$"/��@o��$��b����ty6�<�;�d2�gsê��o i��^0er�a���g�xf���soz�n�{f�,� :��3����{�]��|�.�0;5�4�a٬ $�>?_�_�gphg�_��1�a����u��6���r�<7@��wbl�z!;th٩f��b�4a�%�kk\�qb�h 4��`�=�����snl����:wh¥�o1n{���eze ���%y�r����s�!����>�����#� 8�id�'&pz4i~2��m{h�����'�xh�o�2z����z��-�@aq'e��pt^� ��͹ms �ܦr�ʴ��:pj.~�u�<�f�f�͑q���_w�t�)��zs�y �\��=/9e��#f�ґ�x�� �jd)� o*�/����4�s�v6oj��]����d�z�t}a�u|���7�����im�ry�j)�<��8'qiuʊ#ie$��=1�� u�l#��2kw�yf���?�wx��q��y�� ��f�� �'����յ[�dn%�y��h�o��f�l�y�˪�� ��w���u'3{���p�ae6z�h���yg���va���v��i1g_�v/�u���$�{� $6�d��^�|�an���!x �����r �o���{���% v�@庭h��{eq��&e���k�tn�fr�ge�l3ў�q����� �$=�b� �8a�����2��=�v��t�c�% 𤜓�qf��lp�a��,�6����ع:�^��/r|%\b��c(n2 o��=cm�l u�:e p& ��s���ir^1�m�f�e�k?t ;�l�����__�x��0��p[�v�a���������,q=һ7kgq %�hf��iwzk�q��$&���(=:��m�r��glkk#0�t��κ� a��� �vmf.���v��" �l��z� 0�u&}��m �5#,����`�jf4�nm����/�'��͏�c l!(��fѷ�l2p�"bdevf�,�"&�i�bh�(����ym���,~���g�k���"d��z�o�շ=q�mo�n�e�t���fεir�p�س������gk��a2?f� 0ᯂ,���>���ad[� d9da*0g�-}j ���y�80j�f�_֣�#{w�d1xgt)��*1y�&�;�_~[yu�0��y�j�� o(n�ta]����� '�.o�e쨯k2ב>�2�����to����m����z�����ӕ��(�j�ǫʆ^��������h�i�{��f�����ź%i5�dwx��4hu��}]��#&*c�'48��|�y��9‚�x�b�������~��{�c�f��[y��xq���?�]���θjb�z���?.��se7euju q;��z�;7���7��ɝ��x��!�*:5�d nk �eן�]�"nt�u'nz�)d��s*2?�vf�zܙe��9��?pth�zwuu�z{�� ��������ܬ�'�#��6?��.�������x��#��e �c����cv�o����p�� �olug����?���uv�r�dg�i&mn{�}6���f����zm|cf6���j"���hn��|h���h{�����ڈeb r� �7�{pw 2x� |��[�bi}�zn���/טm~k{-���r�yo�o ����;� xyi]��m�v��r�2�u`�����כ.�x��n�nn�g���(n�&�_ ��ӓo�d1kan��4��_0��˘֢<�^ ��y��� ��/�4aif!1)&�������z�4��/�a�'oy�'>�>(�0��vb�1�t|��f|�"�fa�p�(�n�m��5��؀bu�x�'��m6�t�����z��ɝۗ����q9o�@d�v,g�p�<*6ל3>��'��vf�jh^$��)���!8��:�1f�(�>hn"g� ��t��!�pbx�>أr�l0�de�g�7�no���w�#�β���k; ��m2��w����o�z�����ŭ���|��cm�9���y�nᝒ���m�y)߳�,d�q_-u��8`����vdc��%fǫfu6mx�t���os���gzxu�ƶ,�� 0�<��y=��)v8�4�"�\����^�"i�er\��w[���g<���b�st/����nwi�j���z��$�sw(c� �ꡕw��el�ֻ*:l�n�&o��a�̚>�wzxs��~tޓ'�pĸvvbgr���dy� ���"��m3�2��������f�u^u[�lo�`4]�.dfp��!&}�����᜶*n]v�fs�;/� c�ѥ�֬_�l0���vgf'mh��.��kq���=�i�c sy�ծm���0\�o;�s2�2�f�� ��ۈ��ԙhv]�ԓ(0l2�`�rm���zzy}�週 t�#2�yր��o��8xt.s(s@��o>"�ը����v f�n�#�ip�k��0 �nd�-h��.�ͦ%�z��c~:p�y@��p ��z� ˻=�p��� y�t��f -��h7,��'�v���x �s06��� �4z��l���uއ�����n2��"l,��/r�z� w���' [���vs�}�o���c������j��}�ֈ����l����,z�o�xj���2�7� @�:�����[�aυ�a�7��n�c��;ei�d��cβ;]2;pl�8�pp��ټ;tm_�d�c��w���/�k�qt1iŵ�t ��f����hu�g�w�fu�@ �p�z>�7��f�(i���㖉�a�/�r<�妊h�e5nt��n� ���v��9���1����_%���r�b�2h�_�beq �p�r� m�8��7o�]������u՚� ���" �v ������j��ĥ2���o�{��}���t,d3o�����֩� 7����?c�d�j��n�f�ʜ�c��ɵ�0~��g���ѽb ][4�'�8��n w���ǂ��~����;i��qh;��zm17f��'���q������yqɔ�lǘ8l�l�y%����qu��.�b;[����� �z,.��v!�rp�%�t�i��)a�c ���k��lm hk4o�m-�3��bq�jw @�k���)~&�&=�lo��avus�c@���/�jnf�܆�c��f��i�t���y��c�m����� l}�2g��b�.<�4g���o�nj��ĝ�=�kٯj��r����l2i�;1 ��c� q�f?:e���o�d��jg�'����pr�8<�h���dp�5g$��m�m� -o�1iy���v��ܰ{�g��#�d�>�������(^��x��oůŋb�w��k�~��<# do�b��~a�@��ym��� n�ͼc��;f�9�դz$�� �:>����u"g?��=`jqv��ps�^fws���?*.���o�v&��c id�-�3�n /� rro5�qr�n� l|��e�vct1k�rg1�*r��f=y�lqܤ�f��ۋi�2v� 1����ss���g}��e`d���n�=����@�������ʦ�2���#mȼ�mѕ��k��~z�}?;h(5 %�x��� �[�y8-gpw�cdve&�&�sro��ڻ��0��� � ��k�;����jx��,�j�$���q.����n���y~�t�#e m����t����yyjkic9�諗���t� ������'4���q��?k���h_���a���g�ɕmk�fpv;���;yk��ѭ�i��$�� ���8~��لc����r`�v �d m�����( l�6�`�~���"a��" e�i�`�:?�e*�ȃ#�6�� ^ @�*f�6�%l���&����zo�7��� ��{g/��n*��%���q-��>%��3{)k�"j�� :��n�l8�cw��nh_�ym�x����0�z�* �2�[ie&i�~�[̉l�n���dr#ܑ�z��]����2�ƹ=j[u�s{�e�&���@t�|�ɐ�`�gc�0>���� z�~�ϻx��z��nu�l���t���[���=��t�\�}<��( �4�d7�t$g�_�@y�: <ȏ�_�s< ��&� ��:m�(.�ڴsl�m� ��!��z� �w���ka� �lˢ@a����tļd k�>=�*v��%\z����lt�7�z!/6b��8���޶!)��ci�d�i��wτ-�h:*�\6�����o��qy�q0� � eb�͉"ͦ^��5�zw]���\��2�i�@ȶ����c$�0/\g��4�ehq�rҧg��tҷ� �s^����7���p�t�2����;�<�z�!4gg��e"�vw���o�e��j!��� kr����vx�{v�� �tx���ӹ�- !�uez�'r�*�^�!�d���^ݐ��b �z!y�j���=��v��"_1���i�t�4)�psf �ɽz*mu�pj�d� �6�u2��*���� ��a���o5�rs�)� ��^��y�73���3�0�&��������ڈ��`�q"͕t��dʧ1\��&r��l�1l�b]�~ �,�)�i@�2�(�gjð.q ?i�?�3��o�n$�lk�,#ϑ�� r�t��wz�m��ǎ�u� ����q�n��b��غq-3?���h��g�1j�2�=ʼ�`��,l��cg@h�$q2\$��d} ��w���a��l7����i<q�i�)t�x�2��ql�n&�v�q�t�8�-s��x$���e��t�hl r�!�n}�3b�k�l�3 �aw;s�� ?�m���ݣ�ӊ�q܋255t���km>����v$��o�æw���=�9� r����4��"�3�`������*q��3c��ѝ�� c)e����m���j0�=/�c�k��!�j݌�6l�#�-3w{��`��rmh�:z}��nb��)kp:��nb�k��^�zmbàq2��r}�h���i�0���>�r����e��zգe��]��� `n�l���������cg���ǘ5�<����vkd2���a���y������8͋��6h*h���x�u�wk3���]hğ<�}]��4�ּ�m����v�;(&���}t�ٲp�u�iv��c��".���2������j a�/�d�i�ʵ�!ߏ� '����o���&�jg���kc��r��3��-]���!�)2;u �s�=qĉ/`��b"���a�*l�b ��]��7xu{6`rh w��~z�r�)���>�l$�-)8a-�/���`�֫}���w���s�r���ӵxï�s�,ߎ�g�w�pd^h�u���h������e�к{9��ɇt�v���m�^��r�!]�kğxg1f��z��͚�! �h��t]�䭛�{�˫�����q*3�`ll:�s�;s$!,b��ng{� �c���lk�ku��w�u9����#y.�����\��)�� ��ᜳi�s��'�6��e�_ap��f�rك����b�%9��'{ͷ�� koʥ���>�����b�_?2 ���lpw���n�zl��:�zypn�����wc�.ϋ �� r�us{'�^�4r �����m�)m����!?4t*���\��n=��/�1�%l��m%cj�#o� �i�*ഫ�q�k��vň�n�8$�t �t�vjd�i� g�2at�^��jv_<�ڗh�ld�^_n� ?n�xm�h^������ja��� �����-cδ������1p ��q���r��u�pf�"�?ӟ�2�4�@h�tdbԟ�7g&k��j-i9! �vv���b5���r� ��avߖl�}�ҝh��l� q����&�-��y8���c��j����?_�ܚ��`��23����?�[�~�ny-%��9�o���*ʦ���p�����pk kt�sdv�j�:��dcom/storware/ipsan/console/lang/properties/messages_zh_cn.properties�i�gr �}��?4��f�p���tz��̐�cl0��]���gw.�2��y 4���� w������n���ь x��qy��ɾ�����]�x*��g�_�*�ח6 �c};:$��0jڤ͏yպ���|,�\�7v˶l�i목9���f��<_�_6�yږu5j� �d�^4�&c������ cnğ��bm����çt��m~~�?��3��z��}����":)ğ�b���,� ��و��d���s�ms�v��p�|ӱ躙̱�j�i�n��.alk�b��qrh�g�}��u��sv>o�/��r��=���0j��o����tӥjsܽy��%[�owy��q��*�.�� ї�x����< l�c�t8��l�7�9�n��r��w�}��/����������5z��z���en��uqު��˚֧s�6ko�7�&˺z�'��� �>j�c��3����yep�f� ���ҭ{&�h��cz;�[q2<⦅�5��l����3����xo���et�q pa� ����,��cz𶰫����g���:ab�tyx����t*�1x���b��>lr�i6y�~��:�m�ǎ[m�r����t � �=�_�r���%me�c[@r���'y���eo9���wv���}~9a��o�fʗ�j,��/����|o�l�l�/r�b�2�:��z.���y��c�wh��k�h�0;_����~=k���z�6�k��hs7pm���%�����t[%9]avv��ܾ���ͼm�������}��\΂ ��m�k��h�6)і .�4�s�~j �����f 7�3�� ��.��hgcwx�cr]�t�'d�y����f��.����uk�p��t#�}=.,h?^�{�u/�z�o�br� <���������ɡ����v�����'� �m}�i���v,�����}9z ��ﺕ)3|ֆqd� fx��l�&�yt���x����e]m��]́�y.�ng�7�kn��߾z�h'.5�u�'�̧s-��eo���z<]�v�:/,0}��,��p`,�nq�,:j@u�ufd�{��×�i��6�mb��9�\v�t ��r��f ,aw{x_&y�q��x�.j*>�ӹ ^l�]����-��k��s 8 �l�"�no��v!n~��x����q ��*��b:`e:$a�1��3>:����y��e�)�es�owm�&<ʆ[��m�? �\��r� x������~���f��ܢ/5>b�v��ƭ�9)3ɢ�e�ƞx�b�#� $�-��mpʦ�6�@��s��/��1������r�qriks���zq�օ�]�-.pb�e�v=o���]y����������o_��5��hn5t��䑄˗â�e���c�ޝ�j>� 3�r�4�_��n5�g�}�x#m��¥s��tμh�>�� c �}��缙@e��� ��������`n��9!��iao$!81����ӂ� �u���o�q,vh���6��@og�v2���m~#y���s�8 f�iωxu�0�,_h��a�:� z�? ����� ��x�j����ufhu,p��z=^$�3��q���]���"�[\�\i} $����䶪�� _� ���"[��5ɼ$q��h3���c��o�oզe��h����i#���zב�^���@#�y�:��xu�8�'�(���b�hg��$'a�>����g���0n7y�}y�;r�q�bvy �{��� ��h�-o�d{as���w�d���xi}��uv �� l��s#@ �80�ݥ���vӓb��� �o�~�u(������svtgr' �ki|_^�/�-��u]l9o1ge�jr���4���?�簣�z�����>���$7:[����e���h�qd6ՙ���@��s%��$z�ym��i����7c�esw�vk��}���7)���%ܨne�"i�b��?��}�o�7w�f�=��2�2�`l���ͼ�ŗk;��1m҃a��>/�m�� � x͢-�� c-��i� *{�c�� �  �u���⥟{o��;�l�{#ڭ� �̈�n����'�ix�@"d��,�9����>��oop��[�ڞ�c�>�� x���e �b;׎`}�4�ރ����$�.�w���d���ab,z � ʫ #����m�� b���}�y�n�>k(�h���ƍ4��\�ka��.��]��� @��v)��� إy)�zfղ:]zucфc��@k�t��<�'���jl�������c���5`�nn�>�$�u��>�ƶ� l��i�_��^�;��l�%?q׺\�[n�i��uhj���l]/���<>q�r.6ӕt!�4��o��u�u����q�糄��.6��(�ҫqn�d�g>]r �������z��������}�b��6��d$��t>}�h�r�'q���Ԧ��ꅞ7��,ׅ�q_�׀�#h�h� ��z�¡c����ro���h�j!�6\ss⩗�|����d�fr��h��::�m~��q�ね'�zr{9φx�g�=��'cǯ�t��x�t�dh����ec�0wma���$�r���� \u6��b�%r��a �x�gys•�ict{2_�x�{@�u���wo��}h��c/ �q����8��\i��}qn�j�1�&0�'$�@v$[�l#޹�hf��z�����h)s5i��" �m�xb�$/�k8,��v�}���8� "��2�c],���y�gd�ubn ���n�]y��7�9�w�4��v�4(�6�ѷ߸(w���u����{�lz��`�v=p䴆gzf{� л����6c3j��~a鑛����k'��j��(3@���z�bfh��z�d�4���{�}��bp�]dŕc!��/�����gh�����p��]p%qؘ�û(!�iӂ�ue��'�#�t���\}g����y#��$�\[ݦz�ҥ���d6���9 ���°°�(u��l��|�&�>�}^,��(��q�wf���e�n����'�,�~�t-v��g/�� �p��ǝd�'�k鎯,?�x.���g;�a���f�q�~�#��î��<�a�*�ڹo�a�v���p����ъ�갬.9{��l�} �{$nvb�5�tu�f���k't�qq�ejd��q�gb�9���>̋�b�g��=�叠�0�g�ku��ك�h��pt`���:��./����7�:�����v�f�/n�����5� _�@m��s�y��k,�|� �.o�p��>�s<��<��b��5d^�2-4©n��!����j k?��m���2��7f����qw���k��x�w�-t�ft���0k��t��1m�f�t�:�'@&�l� x�oz� _ki�c����쨇��4��k�@|�9�b<ӭ,w��˜i*�(st�qdl�k[k�y}�!7�?s���q1y��(f|m#���9��d�p��qŭ�n��� ��@z��\#�]�9rc(*h^m�nw`�*ra��u gf�y$>yf lg�*4�������o�8��g�w�)�:'���~#��ӱo$�0?�9�vr�:[@��&����h��,�:�f�$� � �8�'ik?���u���聠�!�sc���wr_q� �q�-g���a��#��ʻ z���l-�~��g �q��?�y�ݞo�?c�3!�'{�e~�|�ִ�xj6�`9ׇ\�|���%�6r�z.��!�u�� �g��<��9>zdi��=� �a��/��h��zn�ll�=7qi9ړ9�j�/�t���i�.�s�h�0��� ��lzu�/ijnζ� ���ukf�:�q�>�p�]�c4�v>-�a�_x��r� ��izp\ �@�i�b�g��1�� �vq^0��]ç�c�b�-�o"&@�#�.g��� �?�z�wƻƣ�d��h�'a�5j�wr����k���w _�'k������#fv���߆�z��ž�� ��i<ǟ�v\��%�帷ơ����{pȓ�� �>0�&���� �2'h�9��c�ɉu%��n��%s|au��k���r�d�"fbr�6gq� e*�z�kr��4��������]���f�b�s����r�f�j�z��'�z������/�j�<��r:�kэ���b'�x><��5��k�[�����p��fo��� �0蕲g��;��3�粶 �hq��b�c�����;�#��f�gɺ�*�8t�0i�jz�x�� y_����c�欱h� ��u�`x����þb�ԓ���<|�����y�dؐ�x�&s hz`��������&������8vw�d; c���if'-����roޝa`�؝�,�fd‰2���rs�uƶ�c}q�b\������� a�2t�x��g��a��`���6;҇s3����c�i�m�w��%�e�.'�_i@!�o`6ch�3�yx�x�'�����"d(���0v��d�]mfa����q�ms�-�҇@v}u>� q��8$ �y���������iy�v��?n=�wf#��m��ޞo푒�pf�ɲ��a�m>��o������ �,�#7j���ݦ������]������ �}� �,�vѱ�asi��ir��a�h�_l���2]s�h�mފs���0�z�!���"�i�u�� ����p���7���s�2_/mm�cy�bt_w��%��ܤ��|: y�����/]��}ְr������t�e�ns}�t��upuua������b1�(em"�o *��`���"� �b_y0�$��幽$������ �8a�s�fc� czi��h�q]��iwir�[�e���m��b,�db�<!h!c8}�e�'j�ƚ�-p[ƾa�jlte�(� 9�;��t�#�2�y�6xo]�/:��|��m�l/1�8)�#��;]0���� ��4߫xvz@jeت@�-���k(ǧ� < �cu9.�0�*�u[��o��s�/����"�ԣd��dg��s-!�=���!u��my/ko�'���/e���k���"1�s%�h��o�]~�a�i�����j6�.�8$���^��t��]��b3 s���-���,��ޘ$�h]���k���t#�� �'�":^ĕ��'��z-���jƣw�,t#�u��̃�@g�ϧamm��߇_�s~� ��xa�|o�����y�9_�� ��(h���/h������ ���}�� � ��i�񘣦y���nw}�jֵ��9�/�k��' hvo7�g)ew������p��,�>da�;߽���y=�3�c�>������h�ᝌ�� `�u �{g�@h�z-�"o�a�q��!������>jd� �ў�u�}�����h�"�,��\��0�b<�\�( ���"`�>�h�<a;�@sjђ�l5�׳ �*��f��kr �m�k\�`ۓ`��o��q(�)������a��'�g�_�'m���x%��6�x����۲(9� ��^��`�lw?����.�x��cϥs�lm����@�tr�m=�==�n�sr5e~vei���𚄲��Ԩ�0~�v�c~�w��er�fey�14��,�i� �íwv� ��2���[l�8h;,������q$���bl:�w�f��~����y��<�6� zm���� f�{��r����}v�\����7�dž q�܄9yo�x,�����1�.b�m��=<ʃ?5�:m��n��!a����b8 ��}��dt}�,���%�b �q�%�(̷�im������s�p }�$�&j��k٫͞��pzj|m���'$)�e:�gl{��hb�^d�;���a�&d8���fœ�i�w���� ��&��(x:��}sj?�sjt i�����#v����ap��ն����i�^v�����o�ˁ����s@���i�ܢts������1���@�9d����|��zj̕���ee7nq��� �j��8b{@r6���� 4��>�i}����_�z���|���p j��5�m�y u���?3bbr�t��.&���đ�7�b)�����pi/�� ^�ށy�1�w�b�dpi-5�ոd������!��2���xg� �4'�s�ac>i0-�(��\=�� pc'�q��al��0�_!@ �<�����l�y�=��?e��_��ܢ�#s ū��-��i��w�t� ���u�#f:�熌͋%�g�.�g��cg7�m�w�}�s�ӆ7x���;�r�^`y��hn�`�tj~i�b)bv=�f�l�:�4��\��cf�m�spqv���t�c�)n�����b�ms�fw�b�_(/�#�kǒ/ ��0zuq;8^�sdۤ�rrӊ��7� ���y�;ޘ6xt�ځ�xz�x�;�c�xfq^�!\�h�o�co�0f҉�a��yѩ]��&�:����m�g� åoe"�2�ⱦ��u i�̕o��$��y��vv�)�[p�]�@�d"(����i��kkz���!�}!ᢏ\����ϻ�jڄ��d ��bl��׃'ƶ-n�8h)=� �t��p���h�ٟ�����(~��\t����w�{�tk-�u�-��u�i�-h!>�(4a|�9��$����^��)�ҥʣp�e�'�rw[��9s �l���������#g����?�� mԉ�}d�j��� �f������hpg��z��ri�yb�����}��g�?~���=rk>�ī�� ���]�h��/����^����a�\wn���� x�e�0��t$�<>v�[��{��}��ԏ���ϲ�n�m�vv���f�����m���1u���f.��<���ȡ��pah�:j���q7�~�:�?d��k��g9?� �z���w���>�y����h�_b�z�g�zgf�_�k�]рk�w���&; n)j�k���9�����t�ֱgږ7,#0ʉ渻며�a?��*><* ��)��:w���� � cf�k@�{a}=�ku�t��ε&��~xn3�v���ˠ�@�s��箺�� �����rclj�/�3q(ɩ�% ��:�:�� �чp����s� {*n���:kv=j/u�f< !�#/�? hg'c(m��$����2_z��i��:��bb�g!'i] ���`*&ԃ��q����e$?f4b���c,ӥ�j�s|;�v�աm�pa�.��h�޸2���0��#��&1��`��,�u����l6�򥪶�:��n�a,�jo��<���%]��2�)]�)�p�6 �s��g��r3w��exa�kӌ��h}v_b*7:�v��o� ���q!����ʕq5��yd/qh��۠�b��k �h ��� `����d��/}x����iv�l�e���t\��h�z�{#x���'����ɂ���j ��gwz]��i��a��8�ҧ2p@|r�p�m�j$ʎ� wh y�� ��ũ�7��2�k�����2=�i�&f���u�]cjs�x3��n�b%r����a �o`�����`1�f�q�٘��e�gl���������h�ޕ�62��i]w�e�ca�2�/��j��-m��*�t�fw�b؇ȋ���b� ���p �ԡ9(p?q�|5~,r�omo:����� �l�*�ў( /�mxz8 >�$m��e���uc��q[g���j��d����и.��j ���@& w���>1��̱�vdh�{%��zy>������nfn/{6��7�s}���/ȳ���)'y�� ��?�;u���ǧ,�iv׷�<������b!fχrw��em-p�m/�@x���|nfm{.om�s.s�.wp�b��c�nh�<���qfܶ������_fyu_���hx����z=�efђ5��l�49l�v���8w�-��~ת�"�7�e>�m�g��s�od>[gzj�9��1}�rn����kr9�x'�g}9y�nlz�.i���#��.�o�r��=�~��nh]u�l4�,�j��@d�c�b���dn����7)_<����nyu�_��#sۤ��z�e^�;��aq��>zwg��f"෇������4~�@ 9�3z����ވ�vݹƣ���|t���,���&��c�n�r]�[�lnn�p�h׶n��z7�;tѕ�������hx�_�;�t� (y/i��.� x��w�'��/x��t�诀p�^ō��rg�v޼~��ov��e����wg��������gk�)��_�j ֋ɸq��*e����i�fi��v�st {is�����ޔ�ـuq�(�� �������ch����0գj�u a�[&�u�e��=��c��c`��3�w��]r�r�`z�8�e�e@��6�-�k'cu� fw:�#��ܨ#�a9�=�(���!��m���a)nz'��������v�y䫹��ͤ��=�l@{ �s��o�g��ul��4�m���xv|���i�(`wϗ��� �pyϙ;��&b��6�ё�j �9a܌�os��80� �?yh~c c's�qn(�����9�'� ?��g��c��c�n>xf��\�1�f�&���] ^��8(�a�3�@�3]s��<ǀ��i&�&f������$��1эx���z��ȓe�тi� t��<с@u�;l��:�%����� z49p4��p��mk��7���faˣ� 8xr,�m��e(zdg����ڃ���tm� 8 ���(�=�d���� c������#��� ����� �{?�ͨ";��9�gj[�����vfg��z*��'99�i��>[��h����~�����#)�]ϸ��bd�r�������� ���~������[eybox�����= ��i9�e~?̍�0��gġ�ه�rv6������_��l� ��"b��^(~�s��x��@�g�f�� d��5ڇ��f�㋍l������li%�a%�9�j�¶�8����9ۓ�:��������o?z�|ѷ r�ʜ 9'�ϙ�졀 �f�z�]��΀á�&�\k��{�k��*i em���z1�k��rby�� {p��[��g�����0�!�n�f'��dn�c�ε�a�*yw5�ǥlz��pf�3.]%؊�l`ϲ�u/�5��ta�� xw�2q� w%�-�h�#��_�d#�� q@v.�>��#�z�g���b�5�\�7nc1���q���|�za���yώg�� ��!��gu�9&�>6��k�#��l�^�]w�xiz]adq�!۬w{��y)��3ߌ���ו��j�f�m�pj�3&���\v�y�ϵ�- �^�����s�ț(�^f���l_3bu���p4o;ad�zg� *x��\�qv|���?� 9e�7`��rki��0�g�"��dž9���5�m��s�ݿ�o@�w ��t�� e�ɘ�Ԧ�ۥl��]�!� y񘃗7�n���n^܌n��5d1�p>�d��?�^��o��wm~r��xw��*��^�c^bo� o n�&˓b~��q��o� ة�8���3�n��g��i�q.)�ez�<m0"�h�.�t����p�~�����3�c}���u�� �/;�nm����!5j �ϗ�x����n�"��i�⇇rgc���es(�\e�s ��2�����yfs^��^x�`mc>�&�57u�=�h�.�o9vz�v �&�5_�}��v�0�����""�4ڋ���_�0@d�*;���'%g}�l�)�d�܌?:}�yҡs`w�-(�>����[4)��}lw���m��hd��1� \��e��w&��̓�s:�<�ঞ.1_����3:�/.c�8p�~qz�}v"a� �_�&9u�%�ik�'� ��ӡ�s�p g��rv��_�y���"����3�cn{&�5��yѷ��2da{�@�&�$�6����@������!�| ��w_���.����-�n@vu#��o:6���wp����уn�j� �̋�n���#���o��ւߕ���l��|��&�����hwݘ]{�n�l�j¦�s_�|�f4�me�h?jr���y@ij�ō�����}�f�����#:��h�6=���r.���-�q،'n��(�wh�bpk��"4�u��'�m☐%6;u�����t�rg�sw�'�gԪi�׵�f� 16�xih6��b"��r��� �a~9������oϰ1���� �>1( ҿ��{ݽ���q���t�r�5g,�@�ݮ�&?���?#��e�@��-*��@�wq8�� �]l��;0�$� d�i$�w���-f��6��iu ܲln�`�@�w$qrq�h��������[���*ݨ/u�����]��q_�h�*o���>���љi��;���:��p��;7�����e�~�)(��%n�җ��l%�� ��v���z}~��m�t���&s�� =aڛkj�xa���&tl���0�hoa�p��9?\]�όj�*sgd�ʚn�wx�n�w�o��/e� �el1<j�ak��j�ic:j�'�i�d�v�户v�>�n�ֿj:zd��l�����-�mh����~���ч��#�n�^p�h��m`�>�b �*�`x y�{h ����jt�[�ِ5 sl͐����f 2��>��5�[&��nt*���&]��@�d�g�a!���\(%s��gww��x�o_�a�ue��}���a����n�pw i������)��#ih�x*��: �,��e5�a�<� n�xyo��j��`}��] )�ul�kr�fxy�p��yz���n�,�]gj�o��� �f��y�=���f����@fq��3�iц��i��t��n��� ��pȭq�n���v �j3ptw�;�(���xj�k���ت<���/�rjq�*]�;�g �} �/���;�0��"�`nsj�b)�f�0��bz�k��t���%��|z�ɓ�_o��yq��' ��ާaݵ�䪝v�nph�� �ܶ���&e~�=�je3�x�ӱ��?㴾ȕ���j���'��h����ja�$c���5x4զ�(s��n(��.��p �˓s�ύ�gtϥ�����=���˱�џ ��7��7���4q\x�� ���\��&���i��/v�4� �h�y������s�tmz���� t�o_��z�z�\ȓ�$�n.�n�i;�^��]��vt�e�g�t��e�4xe-^�eh�n8�trrn�f�j���$�yr�y/u9^g��j*�a�k? _u�%����u2[ �t�$���`[ͩ��&�{��/�n>�:p�=^.���z����>%o�0�'���� ^� s]skԋ�����g\gj�w�}o6 ä��&ؑ\ģi�!����v>֋��s�;�0<�q�����ߖ���x��nj���qtq����=t��ڴ�v�uq�vf�s���3e�.�5���_�z56��j-)q�#_�sw7-9y����vr���� ������\]`��x1���x�.�"n|�f@ ���0l��_�y��l8���ui}��v ����;yz ����w� � -�kn��}���7;�w�d�t��{8�����nz���y�.xso�is���? �r��cw9<�닂��fk�������姊����rt$?� �^=�m����pi�{�b{��f0�-�kۥ.h]���ۍ��m�~��y�t�x3d�i��e�瑬i/ ؤ�-�e�"�c��s����c5���a�k�'����v/=l�a�m^�9����\>��y:�*~��l�t��c��_�ҏ, �yz|$�{�p�j� �r�2e$)�d`2ĵ� ӟ�2�`؈�u#�}xc� �nc �*�=h(�����:�/m ela�� @��zms�w�ɖ��qfau��:�iex:c ˼ �`6q����4��:p9b9�� �o �*�b���™��cڪ��kl��2 "���b q�� epu/�6���u��� ���ht��j:�i��#�c�1���k���znl���^o!h�յxф�j��<�(��r��;�8 �z�l� �ŗ)�%��nlm�l��r ����8� ș�d�a*�,sv,a=ӥ�r�7��j��^�f 3y��e摠|4i|y � ���_�����u/ֺh�ԃ\�>���j �r���vk� *�?����_h4��c�b�a�蝢t0a�>�"��u&h#ɶ�p�8�����r, �u�ګ:,���/���fu�{�k/b�b2ɂ�٘���?�j���ěj�0l�cs�™mt�� ̆�o���u/�u����˗� ��q�@x�8��d��4e���j5�|��%�)�l��`�d�  jͺ���l�c��l�2ׇ5���7�� ~lxejl;x�!��q�o'6斣 ����mg�0���g�;�}sx�g,�c���4��)n`�q���"��d���փ*��� ��iu%��y"�¤�&�ay^|�ˇ,k����<7��<�"�5� #мji��o�\��gl��ex����(�攧[�� ����7�ō"�q�&t ʈ[�� �.v��i>dρ�j���g��|鷐i_r��đ4�4�c �5#���y���\x�s�z�/�i�:�]b!����y~ģ�t��ŵ�yٛøp�ɴ��1 ���0�#������b̿5�j�5�=u�5�;���s���<�&3 fh'��ӛ��8�|���<��b$s�rf�~���seg��������f �d�⯝�o����;ǘ5!s��%«�ϋ��e�� �$�e��)-����i2���곛쬌/��g���f`}��#/m�_����9`�;h2���&���f!�ą��񼚮��m�������߄n_i���َ�j*;���/r^9�r<��m$@���g��c�k����b���ඈ1���c�6�� k�}c���u�#���v=8�ϼϝ�n �.kr0z�?n\ա0��o�9#��^v������yق <���0k�}c0���`���;�ͻ��a��$�e�xl?��{��~�d�&��ԉ/�`���e��d &>��t���x��n���';y�����y`.m[��b�d5=��甌nz��g<�9����&p���9v0|�d�5�k@���n��p����p ���g����mlmn��� ��g 8�j����/lz�ͥү;哜˚��2dro��y�n�y���1h�o� ��0x�d��w�n��=� ���}��r^�>#�޼s�i>_�t�6w!�gywz^x~�"�-sr���[]uy��ctw�n�jt�7\��7�j�(���nbr�l[�v\-ۺ����]�c�es `��r��?�����d�k�9�^�]k_�z�"�y^�ҷ�ٞwvg��}�_��;� ϑ�c�9�!�=�����}y���xcutf �^�b�b��d*�- ����l�fs-���l��� �w7x��4��a���c��ib<�� ��˃ b#�y�_ �w��lu�f�u�"5=u�?��l��_�ga!�k���bx�}��f�ܲw�<��h�yk�"� �v|�5&ƽ�w��1d�.�%#��_���������������y�ri����aqjdax7e'e�]kgl}�k�w�n�i ����j����g��#��p2����qd.h�f�t]r��t��}8��0�d��:�ѿ"ʦg*ai3�t��{�p � ���>�3��!�~���#�=���9�ps���m�|��`���‰`�ojc ��x8v貼�z�>핯o�â xׯƃufٛ� �ڕ��o�j�ôl�b:6���5���^�f�8#yر�ڒ�7�8a��fvr껎������q���k�&��-�c�o��,�ֆ^�{�ǖ�,����b��:d6��r�����.9g�4�e�����$��?t�ϐ�����~;�a�a�u���c�3p��w��{���jpz֢8���h��cq?g5��o����'`� �qd���at�%z�q�jڌw�[&���)�mܻ�v���lj'n��q̯����u% ���������p�(����ʡ�~g��u�y��: l���ʃ��:�ˋ�m6�af[�x4�n���խؤ eoi'2pd$�q2�cl��0pu�|��b��;͑� i8�|��vxp"��dn\�,�/�\�e�s�;*n�z6�\.=�(�y�&��z�t=1�%y߅��\l�nq�=�0��u���s����m�oi��~��cj^f(� �nɔ�5~�_���]qօ��sv��q �t^�@���=d:��)ҡ� �pmhro,���� �w�r �uaǯq=:�m�/��r�zd�f�e��t�sq ("��a����5�?yt@ڸ3�6l x~�^��ӟm��gr�,��{:����l[!>#�e 8&?z·p���������a>9�#�rz��}�p;����槯����ݗ�k���)�d)�߭ 3^��?}���*j� i���-�ge|�ᛧh�i- �m���n�,:��� %ւ�@ r������'ӿ�rh��(�&���/�� beο�"2/d���ްɛv���?h����丂q��x�s��w�����2���[�)�,pc���򂾔u��ea{q-:b�|��,�c �����50�m�* �~o1d,ڦ�(�xu�r���k�w�����5������������-m�l�_��eō��p8h=q��z%`�������n�y�֔&�1�ju�լ&>͞�g�c�ow�ie�u��� �l|x��ĉ� #ú�z�s������d�@5<�x :�:}����9���ss�3t:�e�� }u�)�)�c�v��~k�h���o������/�o�l��t�9!4��m�a,cnr �tx�\f ��;�9!%�d@1*l�����3;��!��ոaorps ��o�q'c�cp۔ a|�y=��|3�;���h&`]h�o(q�jn����n��4em|@�����<�(a�l�c���;*6 s��t��o������ft���w�>;b܅vx��c �h���{fp���p��:��t8�su����4�"jpeyț��͏� w| �r�#���ϯ�e7���1 ��x�{�{ūw�}�9n�/�2h.\ ��a ���� 7.,~�dn��c>:'t���;e��}g�>�c؍�w��b��ޤc,7mb�1h1ul�a�9�du�dq�����]�rq�ܥ�l�ʸ��u�an�i�_��!�� ��gq� <#\s!��6�1u�v�splϭq;ٕ�l�.`��ެ�]����;1� �0���f��fj}��j�ռdt����k��e�5p�u�$���b���}��j�o�����yr[��r�n��a�ݻ��:u���fy�\s���q�fz����0d`na�z��&��$=9�]�t&s�u���k�<-;?p9"�n����*°g�쨜0�o<�]��)ʌ����)u�iӕ��4�t�c�tvd� zc:�<=��g��y�x�r��겒��i-9�.c�`��l����g�i:��� �!�� �91 ��1�ƒz�\lln��ws��ޗ��pi�l�~� a5~���<{c�q<�h���m�n���><��|i8)�̧��g�s;j&h#*�i��<:xk��v1'0�em��e��v�g�lj� 6�8�k]�|չd�h2������|�����ݴp�n�c�j�t�ѡ�;�ׂ�f�6���� ���?��ld�ci��7h� ��o2�y6�:�y�8�{�ǩ[;_���'\l����ѵ��`�@�k{��ʯۇ������ �{ex�u��&�&�z'sc��g���p1�c�n7�9 cm���>��g�v�‹�c5� �����ikc�˾ad�3ʊu0� #w,�o#����v�ko5���(q�a"2-�,aé%�1.�����|~�gx�c#���p4�gȉpr�tj#s�y!����4�;ȳ:x �od}��d��;����b��˶��ug`v�l0`ۛ� ��ӊ�d7w��qȓ�w�8�*ֲb.��s�b�t�ct��cu3��1�3z��m�!�c�>��ݍ�sx�&�x���':�rʼs.�ȗ%��i�ɥu'�v�ѯuak� e�r�95}��u=����k��w���=��in��� ~� �:wk^�jy�jlꗜ9�8�6��{� .���$x<��)w��=2v�2v_�����%��)2�dk / ��!o���hy�o�9"z�>��������.�e���j�њt����2^���ˡ-�����, �x"p�e���t����"�|�qa\a�j�m��l���:|�h˘qn��o�4��nw�`w�h4쟉;s{�i���ޑ պ���k��/яt�� �g�#kp�)j�n1��?u%b�uo : >w܍6?wm����.u�!/��v� �ֵ��c{ta�����8�r�y&�q� �б���t��\���p�f��r�bwv�m��������n3�.�@��ٗ�ʑ�eh�5]x>��t!xopi�� ��nv��֖���d�'�9_jen(���a:�]�����^��<���h����9�9qb�=q\�c%��1uĭ�v�grə��"$bb y��1�*���pɩ1����ί>�!�ӟ�s-*;��b����m�l��5cѡ� ��t�&/���l�,��x؀@9r��*v��ۺ�� t!'��`lqp�p�!�c������ܨrh�\a��a���cr�7o>�0��r'��t�wr�,)�l��%�`�$m�{��s(8��xs��q^q��t쾘�� e/��(r!� ҭx������e���i%� t�ā]���~w���ҹ����=�:���(ւ?��8]"�g�l;�4i��k�w����ʞ���814�s�1� ���ʬ���d�e�h�r$�uche�p���uw2}��﷾ʒ���~��?���m�;f��.�97�m���i��������)'u����-zv�r�o��ᥜu`�d��� �np�mp���8��e*��f�&�j2�l���������|���od)��6��� ˶�ǟu�e_ �pf�j�›��-�x:m\n�?��5(��տnm�ft�y�2��x0jȥ� �3m��w, �2u�u�"���‡�ʠ�d պ}��sz�{h���k\nd�\ڟ�,�2 �ve=)�e�l�h�f�]�|�a��臻&�{�4�����xˬdt`�a5��,�:#�8.cϗ��>����� �7��(z�窬j��5���ũh��琓��0'������m�k�e5�p�pk�]�z���q!t_����/�n����n��@�c�����z�y�z�.���f��k5�q@)ѻ���m�h� t� �! _ ~�a��mm[��[����p:}\¦^�����-9��ސ�"��*��l7��u����fc3�d�8��ٸ�����y;���y1���cb������[�x�s6�1?���k��b��!�n*(��di)�2c��ֆ6�n�jh��k��fj���v�ӄw �����֔!�:���n?a �a��xkt�vi��kv��2(�ʘ �!��d(�h`b�$��q�fa8f�b������|����2oi��_hv�f��y����������ʰ���dۜ�r �δ���$tgx,�x?dkƙ���z�k� @��z{k�o[�(�f�9�!������h��㕚w�!z>�qk��vi��t3j����?�9�w�j�����n�l>��� ���ٿ�ltgkɘ!k&{f&�ա$�dh�o��5�'5=&n��j�pj�k���m]zl](�c2��m���-pu�i �w��1�.�փo�v��8z�b��%�����_e� �w��;]ɴk���w�ွ�'����og�obf���!�� ��y��.�^������(?��y��x����3���-�ȗ�% ��(og���1��u��qڛb�����=%��cr�^�:t���[��v�6�������ǐ4#�rp n�c�b>$��rrn��wh�a�d0ƴ.��e�o�r�c� t��s8>��=:���*sz �j�їj�c{��7�c�f��eݓl�l�j�^�Ƛ�l��u��3��u�bkeo͖���՛]�� ����|���t��̑#n����" ������e�rݍ�k��d�yw=����j�pg.|?iu$&��x�s��gґ�p�� cmfh��� ��8��he�$g[u�y���&�)m'�>� ����2��ccuϋ ���o���(�(��p���e���"8�!��ax bq�'���β]'�����i��"�l�,.ҍqzm�b ������n�[ ��;���f>�~k�=�mc��}k�2m����� �����8��m��")�[������"��peޡ���krc�����������tes�vp�j5�0�gl� �c�}ȯْ���d�� s(�(�������q,-��?b��:~ao��x���?>r5�d8k�������pp�����o�rrtxu3��c�)�����}e��{f[��-x� ���{ph3`�&�{3'`tt�`�b/��;�畡`��? ���g^�sh�u�v mm�� ��<{��ϯ���r���[�nwp�s��5��^&4�5�1]k�/i��\ g�)����m ex,� ��rm�9��_�h�o.mv1��m@v|��6 t�,����x���8 ����� ��z\�)��xj_s����<� o"9��^15� !׭q�r2�mp|2�i 2� n ?s*$$0j�ji��\y��x~�c�v��y� �{m���4�q��u�f򊡒if��c(x�ezfk�#��m�-�>�����e̸>_*�o��8jf�-��f��]@9oij�i� <�e�� �q:a� t���a˷��~g�9c���d�4�?������d�t���21�†�%�:д]s���%2��瑜�ƀx�̍����[��ĉ�un�m"rz��[��q�����m� n*�j��u5n0c�`�(��goe�di�'���� /r;dy��srd{&糠,t۵w�d��إ��'m�֊��y~qm-,æmvq.�����c ��x-d�˼�8 ��#�a�/g[k5����b�>~h6����*#�����晸 � �_�4$�ω�����r�z��- �tl �v���a1�xy�)��wyrj�����7dp�������� �̔�ogfk�l� ���"g���ɴ����7tk�wc,ʼnsճ8�0 ����`�d�,|ؽ�q2e������g�>�$.���yq�q�i���2 1x����|]>p��l�1ɾg\�ۯr `3��]ө�.��5 ��j�4�ї���0��xwm�o��&ౣ�o�1��c ��<)�-�ze��f�t�/ g�����?�ד�t$h�h<�(�]e�����m(��z��u|s�w�s�ycu�̻�jjg��r��/��sx���7�0��3}h���)1���h�rf=�$vk="�j�p��x� ü(���%o���d���m��:��srچ��/y6.<�*�p@�&�����u9�=ƒ�����d֖"u�"� ��w �ϝ�ku��`b��f��q˜���q�x��"�����j^�����d���m���,��{�c�>�oa?���wn���&�bqq�v�ce†�b ��1~mv��u�������~o8�b�n��7f�e�c����^υk��:�ehd�����$�t���qf=`�b�f)���b!| ht���f)�1t��!�xrfdίzr{�nwt�\�&!�tx��m�d��#�=�-�u@34�� ")@ o鼹��#� ���"�b�;�ev y0y�c�@�b��������ǁ���n��c��%d����/b�e�t�ϙ��uc����m{or&�cyj��e�xfj���%����?�r^-�4l `t�z�bv8�ob ���e(��<��q ��ke�!4}�0�e_�yx����ul>nwn � ���.2�%s��3ir�48/��d� 1勛� =t0��c1b|��r�?����pp� [biۼ�jp�^�ӈu�r��*v��9 6ka9է�cpt�4-ق��x�- i�nr�a����a_*/�w/�6�e���`��pt�q�x��/>w�� ��ӌ� ���5�x/k�b�-�'��y<�*<��iq����3n�� ����͠�!wz���/b�gh��m��ery��av�}�x}��q7 �c1�ov梔y\x}s����i� c����;x��� o�|,�c�����[ң�$%#˩�9ϟ�o��@ȱ��s q"��]��]�st��ф�c�oq$��h�y�o��n�1]b�p�,��x��&��u7�pic.~�d�>^ڒ�q /�dn���9!����ƺ1?ʼ*�a:�����mx�[�b]�罐��jt~�ʈbe��si��:�m�ù��m �hy8��xg-�'g��kpu�x)m*���3ڰx���#�g�h�@hp輬�ѥ:&ఇ&5���ux(z�r`�7[�v�{u�p��ƙa7&���m�b�~�[e .'2 �bo/%��1�1'd�(�*!�(�%��b�-�����ԣ\&�g ���!�lc\�,�d)*�mk��ծ?;�ms9a�r��ń�8�u��y2l�碨/u�ut�π rе�;c*���p@�sm�wȣ�i<$:a�{�\ާ��c�q�y��f{���� pl%��q�ф��|���f��7���2�3(�����b���������������~e�^�.��j��4� )_�m/5'��n��eo��o��r�x���#�o�$�m��.de*"�@lpų_�� �j��c%m��x�85����o����y2��a�e����z�֎`ǂ�l���˨f�s�� ��q��x��z����ľ�����h�5���7fcw���m'�s7�p�r����*����/��a�b�u�^��ӓ��u s�mc�.$y�rpa��r�ꔓ��-�^@o ����<�p���y��g��b'kt��?��.h�7k���p����r��?�9�2�����r8�.�j~�j�j���w�>j~<§@��e�a|`}iy�o3����ݰt�<��b�b*�݄it݌�mu�a��ֆku_ �oʬ� ����w��̎o���iϕ�;h�l�����eim��<�$�dr=hc<��jz'0���5m�8����ez�۪nl�e�ާ����s=p�3n��=�g�hc��c�����v9�e�c��sg�6���n����c����ɨ��~�c��a��d�l��xܑ����u���>�@��j�y�t��]�j��l�wœwk�y��n|^wt>���&�s~���f7���ƣ����cɀ��>�9&~a)/�z�/�� ������e�7vy��l:��9�k�yٰ���n�tal�n��3 ����cv���t���ˣ�vڬ :w?��,��s�ze�hf��� 7ѥ��wol � �⚼-�9y���q.�t�w�u���(p�m��!� gh6����c�.9���!o% ]\��{�,����!x�h>^(;��7���m{db�6���r����h'�g���܊�$�f�i �r d�s�&'�� ��i�29���u���]"hم�]��<��׫� bb��d{â)�*pz�,龎��@�i<��| q#��g|��̀� �ũ=a��ӏ룶�!�k܂�*�;ו <|3� %cm}r�j����(� �w�gp�v�ia窴5 �?�e層h��d��"`���oɴ��4��6����׿\��3�g�eer z�>�j��rf���=.��rœ�|�2e����$�7��ٟ���q.p��f�z�m����a��.�($_z�x)�>�s�����6 ��j�_~��_y*�\�6������n8�8����*⚡�,�����t��&^�� �q�pc=��u��~�� �qn/:k���nz[u�ю�v`�~�f�-��y;�bvf�s��ax�ϙ�r`p���f$�c`�u#f�gvk�a��_�p��4��_�j#p�&9��٪1_ po��y��:�7?���%0�?�9$ni�v�/� } )��d ��s۝�]pe����t���v���t1�d e�d�'�,\���՘)'p���$�מm��fa��u�w�sd�g��jt��}a �}m�ч َ�c5-��y�sm����a������ₕ��2ghm�(�(ü�::�l��u'��e�?{d�)sc#��� i x��y �!"cgm�%�#]]�d�s2����,m|��m��#�8�gk��� ������ۙԙ�m֎yi�c�b���q��q2����~�`�m�� �r�/뫲����5�����2�no^b,\0,؉� p��Ჰ�lv��0�������z:���w�r�b����#p�_j�6o" ��f��d� ��f�2�x�f3r�$*��p�1phʻ�bavuv�du�[�o6��]|5�hh^�r�vp= oq� ���=�uy7q��ɷȯm����:h�|��\��-x�ݍ��dere�qf3�o�hgydy�@m=e"�����qj?���ė��h� ���b��)c��`ђ;c���q9��k�b �y/�6,���j&�c)�0���|ό�v��y2�u郕��]0(�}�tlt���,�yy9]��)�x��������q3~��ݼ���l�s^��i7h�9�ʇh�la��� ]z�*�<; v0��>}�`:���ehcw�<�v�p�u��]�ؒi�;g�8��s$$�>k1x�ecwam4��o�9�was}v�u�2ba��d�~`��fag�,�ux.�����y ܑ#��[����y�!���=�k����rsb �]f���f� ��� �#��h � �g4�m��� �8�fdə*���iw$4���p>a#a�������bs h���tɑ�h�o�cpvswf����vݛu�%d%� 3�陘�8�� ���������j��#"���4ypss�����t�]ڃ�� x7������c8���%�x ��ȓ�a*�)|gs�y*<# ��ԋ��yj �b��u������cyke��\^��4�g�@b��i�`o�q���]�|����y5���8bp�c�x�m��]�o5(�y ��slߜ9�������� y ƕ�h&÷�6`��m lv�=b`�6��_��6�.�r¬�d�@�� 4�������5���f֨�&��c�o��8�=�꼮fw��\"�@��p��# �,fcr�oy�3̅� y@�/�a�4��e �� �x��ihu��������w�69�a���a�&r/a�b|��s�]ۿ:�*�3y�^zb��b�z$�v����.�����ˎi�g��m��b�|�����[a��^�㫏��a�2 űp����u;�8@iߓds��9*yn� ogm�'9���6|�j=ҏ� [u�l�t����s0t��c����qr-���m��,�|�`���i�aa$�9�>@4��a���j�3k?m�,j�u:\����a�^5���wj���rĝ���d�o j u�w�����?�j�q �s�7��ŵgz��;4����u� /��|$6;��~x�6ɛ�7j��lڬ~����y��ٱ�ß�������w傋u��b����9ga��w#�����-�w���[��a�/(j�& {�9x�m �ԙ8�>��4t��w]��.���g�37� ������v�t�ⱦ�?7�kí�� ݘ��lźuқ�h�##k�����(r����g�#����a�� �z�.i���.�g���-{�*#�<�c� � ���vg�z3#���k�֪k;�k�k�˹s[p#n���>�qd�.'�[4 ��t�[른� b}'tp���a�ph�g�v�%��t}�p�7èoy\��zdk6w��c�ul缓g*tt�r����jj dj�k�|m��k�d��� ��' k�z�`��a*��q�{���d�`�h ٵ��lj����‘�kچ�/j�x e ��s ��y�e�ڏi�')�l�u�ڡr�_�g��8#������>�tw� ύ|���'ms78a��7�1���$x�6�*��k�ُ�8����q/�p .�j{�oz��ihsa�б�o=�1��ӏ�n*xs��{t��?�y�?e�֩�[��zuj@� �l���;�����q���'�r[�ޝe�$ /�x ��a�km�;�tʧ<�����xcc�k����������>6b���9 l� ��6� �6[�(��{�ȑ��r�>s0��/b �׈��y|f�m�a l2��͂ӡ�;,�� 1l�xb����ɼz g��c��d�1�&cu�=����[���k�vq����w>�t9�����=c� ������d �/��ɜ�*8)��0ӵ��9� 9�"��q�\�[��6�ӿ8�@)�b� �����c�7�r8.q�n�%=�,߆"�`�[{ee�ﴞ�g��(�l������ 1g ,�� b��mw��wz9�9,*��giɣ�p5�0ɪn�!-dq6!�� l��2� km[-�i~ԉ��]�����d��?�e�(̓�~7zn��d!}�|j���-\g0�o^�#��8�g��0sb2?��q�����d��zhe���"� ]�ܗ�p��>�����|t�b�o�����2"̧�5*g�\ϙ.��c{f���� v�!����;�np�v$4� ���-ǃ�l1�����[ m� ����y�p�v�>�z��aa mgp�i�{@� k�ձ��-���_}� ���mgm�b-؅s�e1k�#�s={�_u��f ��3��rk%ye�1 ����o �tc�)��%^������{ktۮ�����6�su�ۆd_�@�o@����oz���hgaf _�>3tʀ!j����9�t�/0�� k~֌�4o����g8�k!�x �:�ŏҧ]���d\�x���jvf������g��sg��8z�z �ūb2f�mt�̜�� ûg(�4 �q4րg s� ���d1��d�k���%qe�s��v��{��"m訟��gډ42ⱥ���yy�,sp:�:�2����i�nݍ�vpn1�u����c��^g���ht^�� �t�dr�ڒ�e�z>da���6� �‹���h��m�9rפ�n`�en�u��)wj���f�m@�)/ ��÷���q-���|��c"<��t�e���y��sh ����@����#`dz¯&�� w�m��<&��2��ko�ūj� �q�iu�։ 0�����)� ��2�t��b���ȕz�ǯ�<�5]�y��� m��c�'l�`�5/kí��*]8k4j ξ���fzt[��_e̝��1gdw�_��k ���rbug� \������asm��ц`��i�}��n"w2گy�3|�5��.w�vobh1|0܀�����k���ڍ����3�ƃc!4i�of7��n��d��e y�rˠ*0�qm��c��f?�������!������;�a�ia�u��!��jiu��hn�� ��k�p a�9� s�5�м��`�qat��g�8p�/=b}�o(��x��7���ep���fq�*=��?|��t�-b��rz�>-'uhg�iy�r��>ka���uι�p�&,�qe�l����m���h)��]y!?q��c��ҳj0�#?�/�^ԥ���k)�zb�p6s�w}c�dg7��xu�� vi�p���p�!]d��k(���p�|t�pc���r��#j�.p�e�&ke �xńc�t�}ڊχ��e4��}� n�_�qw��9e!��t �"���e<�� �r���}8� \q�p��"�>��js%u�$��3ό' �ձ>m<�x�4sf-(�����ۈ0��zs�m,o��2d@�,�f>���,t����w�'�����)y���!��y_�0'��6�:{� >�μv����n���p8c*�d���^���r�%��9"�^��ߐ����|r�k���yv$wb�v��f�]�<�c������kۥyr~���b/���sl�l��#&�بbߧg� m�t��y���m�������z���^�v�uy0�e���t�#& �73�w� �pf=��a&k���t�����;������î���m���;pe�r�h��1j� ;�=9�]���y�d�8��b&g��-��&嘃�wt[�$�x�v)c]��k���ݥ�d��e�{qv���. �0�t5��5�x�wf��?�����.·��a��{d�ǝcuvu��|r�$1h"�u�}�\�j�efl�ι�ky4���r�p�v ����h�o�����'��r�v b���&���$g^�h�i���,훲�fεt���6 m�|w��2{/�:_�}�h�$����%y7��p~�%k�3���wf�[�f��uܼ�vfw�1��}�}��o��:��7�`� ����s�2��$uby�%>��������и�d�`m�,��z�'�:��i#�f�be ��o��m�b�mc��4hg�]��xh$�fwr�q�ƈ�1(�g��.�y��i�z���cw���h a�� �4��ʝ�o��x=n�'r�!^��r]�_؎}2*-��b�~5�f"��u����>v��pɨ�q2���xz/�� �r����tyf �g��sfh������g06��ka�����ć�������c���up]��ۆ��4g������9����ҵŧʚ�˟�su���=vf�eo�վ��s ��� �}�4�.wm�ga��w !xmg��c�j� col�ʔ| �t���9����i��p�v�������h{o���j�{�0�>泝*����&�]m�>a k`�8�u��a��p��[�.�!� }�b����ǫ��y� ��^[�{ra�e�o4]�� v_´ln*l����q>��ĝ�� �baa{i|���u���%u��/l�� ��z=ӷd9e�x�;�����2y��%j��� 3�x=�����`#?���"a�rpr�"#t �!m$xi&j��*j�}ܞηb's��^8�}k�o�����g��o� 6 ��rod��#��x���������^�?������������_z�f5"�$spi{g���r�p� �'���d�靭ՙ�^v�_΢�q��$�rr(y�k�e����v���,o� ��m�%�k"�j�jsi��j�������m�gd��_v��nr��/n�"��s<�2:�m�5��o�k�a[վ��af�o�}���;y�l�������� ����_r�7�rǘo�*b�i����a72��g�r������c%��/�*��υ� �z���f(�d֛���gv����b���f��x���^�� ��c�c#4������9���m��u���g��i����%sz�]��`ۚ d�h��;qoخ�b7m��rnr�7�n���^!�` ��g#jey@xe(bc]g�h��f� �d���`o���3�m�n�b(n��.����� ��-�9n,�xf~�:(�x�׈�� nn {����>\��� 2 ҿ ��ty���\d=�q�����z eqd�x���q��]�0why�k��<t d�3k�=,j5(��r@��qj� �o$kbpu1�������gը���"�hg�vs ���3�j0y1��_�֒,�ɠb��ٙ����g�m%/�md��~��g�{�'� �s;��7gޭ ����5���\���/t鐏c���no_�yb-�q}�?�{j�vb����*~�ce��7e�-����6�ox��;�ڶrl���o��,�k,����ȥ�� ����˕������uu���~ot�n�s�ai��a������us("�npiw��e��u��ȸx!�>ct��#�->ɵ�f ���t8��4z#��s�o�w�q��<<�poyc1�=����k6wvk�w<)��i 삃�;3q��1� xz��rwx�ks| ����a��[��h��k��f���721%�x��\t~���5�=� ����$r���d��?a?�ٕ���!�n�%�e������r�����wq � �%�����i;�:h�4��jtrs8��zv����i3d��pi���v�휄� ���g־��2�ub �le@� ���?k�o������e�^����0b ��pb'i�p�d2fyҡ ��o^ԁ�iαt�x�džn_ 1$e��%��_7։3��^����ߜn5� �71wy�-2?a���r j5����x �=� .b��'�������t[22�q����b���%{�i�ԣ^!��7%������61׊^�{%f=�s�%s�(ޕe�θn�hj� �1mq%)��m�q2<��ۣv �kr��bxo@m� ��wl���$tnt�'%�\���b�n�]sh���� ]:�gk �p�鈕[�|c$� )���f/�~�%�(�x�n�i��cp����l�� ���m�1���v ���2q���@f��<�d��2����i[0� l�9$�/umȧ>�����~� ��n�lky�|x�����;e���j��f �l}^��8 kl� �d��_a�e�/��*•�i�%�fe���h�]���e�檭��m�"��[՛{����ur���$�ľ�o��u���us`b,��3���4����j4[h�a�>������}������4�����7��e���fe`������wx*6 3���o�h���[���8os������ dh�7k�wm�g��7�z�&��m�ڻ�����m ��pk���ջ^op�n�fӯ<��p�fw �k6�j��)�m�l��6_]z�û�}֡��{ ~x��t�=�� u���!.����(�]jlzɳ fhy�r�n�~���u�كģ�2쀫%�y���?#�~a.��� �zyg�*4=�''ˆ�ř7̤!k� v�w��s��0m�z�� 3��h.���0��l:�޻�1l���( !�z|�gp�c�� ͈[d�z�x��q� s���j�i�.6ki��0��m�-q���;c}9�����i�zk��u5k��'z��6 ����b��mq� ۊ�a�e`0 y7�(��f>�h`ٴ8pm��ʇ�����#� �7߆�`����s��,o3�s�<�����v��mh����j�r�t`cf1dk�ݥ�}��o�g&�6�@�{(zbe ���,�>�<����m�r���q���>�򯀹ȗ4����_�ec��\d��l��-�~ �0=,c��|��f܏z��|�3�#ń� l����p�������)5���i�����ply|di<��os��~�'���tnj��l :��ؙ�z���q<�d�k(bsz� ��2ѷpb���':u���y9��۩z�ͧs�w����/���$��kweװv��j�]tq#���n~c�v�ϟ����iշ̾n.�$!t4q�z��f� f��������| �$���;6���e�"��sa��x��py��z�p;�%�k�x1 �w᥽~^d��x�iѿ~�9� �2�t}0p��h�3ktmu^hy*�kg���d����/&���oi��p�$���̕������sq����|�6�� �ʠ1֪�7-���ל�ա�v����wo ��m!�r#�1��:���������&7ҥ�zo6 �%(�� "�ǐ�u��eα�| kj�m�o!f�f��,�e�=�� �a%�v��f�����|���ԣ'�s�)���\n���y#ɯ���_��c�ute����,?ɯ1�������ssse�� !]�g9�u}**\��0^����ɍe��? �ź��q�w��ʊ�-s�>dܽ��o�ri>6�fm�k>� ��� a�ɢ���?48}x��w�r_�ՠ8���4�i{�����|��)$7��i"��l�x �ă���:�]q~\��(�%�(6,y ��1�������m5qw�g�|�6b��k/bc��lp7�y�@�[l�tn�d����ep���aw^ْo��/&��xn���n�:2���(ە�@��68��t��‹i�����m�-���y�12���ͱ\�!�h�do�4��ʋb-na�~w���k�u `�5����w:qv�p����~�_��|����e�y:z��y��4���vi��}l2��<�aa��� ��0�,\�,n��7��$�mou @��ޚ�o�o]bl�n amĭw]��{�z���q��;����}ޔ��7��(n� ����rv��� 9t��!hk/���� ��,f�d��27$�jw�c�t֙��*�ȡ�g�� �%�� �򆙎s-b�"h��}o�ʦh���m�b��*zx�eښ�r�m��bof�����n ���ih���}�`��"�������q�����k��n7����}����as8b6{��gp�m��%@vjnx����\ �n}��cpt@3*zffu-:>��ɖa�� �h<g�@}�bty� ȟ��� ��,b� e5�d(���=�"�jm��[bh�����͏_����bq�#���i@wp���"�m�/�,��.%¢�m�s�_��e � g�l�g�e�a�m6d�([�x�m�ٞ�����xpdi �s��o��(� ���[��p/ظ��9�z7eq>���pt���h�n ��ܷ��d��0��f�� ĝ�9\�jk��x�agd\b�p?b`�*��bc�ab���aw�� x�d����|8 ]��y6��"��� � f'~�����ou.���v�j�-f��7<9�������<��\�!�>���`b����'�a�^k�6)nm�ɛ2 j����ӯd��y�ȟ�z�<h��φ��;doz6���o\�n0]nog����d�����,�n5�כb�t�@wnρy�}�����$ֻ �#$lsk��l(�cy��a�5:���v�h!ie�i �zs��[r{1c� ��^�����֣�22����#�6�eۨq?�3y"�k��lӭ�[d�����vt$@���r���2�ֆ!9i��>7僐�1�)7�m�vƈ�dp�l� |�'�6�2f}z9�gmݜ��)����ut��u�!�*d��mbw(q�*u`�d��<���{ri�f;��o��,՛�t �reb(�bj�[�*d�����y��@��?e�l��� ��%k� � ��xԏv��8�-ޕ��n�ًw����khi�d�ydb�.nf�gf�a�6�l�()2��h������q�g$5/��$�hjv.��<"�97̨����;&l'53��� �im�(�g�t���4w�n`�\17�ms���m�y!�d�}y�����eof� {���}�}%?08�t hm�t�� �_��(޻�y�𲜊��{ћ��m�3v������ǟ:56�0��}z^��� ��{fc��k�>]�1�a<^g�����������ԯ�j���l^ʼn���ofg��h�g��������ozs#�eh铑�$$ ~.�������� ��ͷ��c-�<� �7������w����r_�����a��xs�?>|{:�1�@�c��x[�ǯ��~���� �s𛟊o�}�)��[ �����;���?���n�9h�{;�ʿt���wwu��,0�wz���]�����p�遥�n r�l�o�g��ft�r--ob�c �i/mru�ŀ9p���r��ë^��ç������&�n"%c���69����m�e��lt_�?�f��� �3ϟ���cu���b�$w:��8���y��)���j�!����@��`�nz�&`>��c�=nmb��v"l���tz?�<�� e�b�y[[�� �5b:���ҿ���.b��^�9#��u�b�i �(�w�y�"k�yĺ�x��r��|ty*��@`��ɋi��:�����ko%�p����z�������c{d�'|�|�����l�9f������y� 9��\b;�����-:��bo9e8��h�ṕf�� �y�ڠ�{g��d}���3&��5.ո�wb����\/�й�_?�dp�h��}�^bus� ��p:�:[*a���,a�u���r��@��8 �zˢqi8���,6u~�^�w?������bm ^�e~[�ϧ��rf�b����������o޼���l�]q��������c��ԫ?�������v^��?�{���b�?���������ϯx�/os�"m�z}x������n��c�ȑ�?���77?����ٍoœ�\�_�b� ��t"�x���.$�uk�lb��l�i� �r*/��4g��̂�g�dt�v�s)l��9migq�rz/t-�>|�>v���*,׃�uܲ8��:�a`cg�.��sz���:�}sh�2�w�je��g�&8�_q����i*��c�9�gnq����u�1ȝ��)�#��ԗ�y���z�n��]������0��`@���)q��ot� ܎ ���y� ���n��l�3:@�y�; �fcd��o.���ԉ���\��ds4݊��~�֦�0�v���x\ ,�h�`1օgyq����ݘ���})5\���g=y��s�uj���?����=��yh���`�mc�"��ga�9�c��ns����瑄:�n�1b�ct ������o�h������nf*::5wzv�m���{~ �n#��p1o���=�c�^蹔1m�h����f����n��$��2�l�kv�$��`}��� ���-:q�zk 0�&�k{r&e�^�q =�����mp��a�p� t @��m�؃2�u&y�'>!#is'af����mdyp��c��'�� v��v�h!3fn"-\.���9[*�r����xc���heaz, �b�2�s���d��a y����r� !�{���nbb�#$�%qa�?�[ 6f�l�->i�s�w�0�x� /b�i=��5&2e�r02�z��>5! fꐤ1wc�"��q2.�gvi�\��6��ݼ7���1������򖎰�36���i���6y��� m��� a^�(z�w;�ku�!�c� nԤ#m��pc`�!���do��mk�rgս܉ ]��r�c�w�y�{n��<���6� �ef���f$~�u7�*�.ue ���e�a�b����1���� ��a��n6#�����("g %� f�l��r��v�]x��o�xci��%��ɭ� �.k���=��5�c�p%b��� �;8sۄ�*g�z �\d x"��~�a�a3� �ga���#�n�){��#k�<ũ[`�:#8yx�a�\��&�g�da��9���ml��i�=!��_6�/`~l|v��h��j��@�6}���b�p/#��8q��v�1ߐ��w��������,z�5vo>����� ���=[�[���9{��0h:�կ �a5����׶�ao�����4c4���2h����b���9$͏.-���.䗦��e)���� �������$j�ˬ0��4�2�q�jh�t)��b�����7�a�g-�i��=u�\h�~��w���s�\��d(14zk���5�yd��-��%��k{ye�<�c���ҏ�gm�xu��ct��╗q�λsq�#�x��❇������غ�p���n>���縘i���`ə�k���>���ʻ�f>�w��kr�f��j����v����7 �bb�u ���e3��0�xws�1&�jt���2�ᄟ; �w>0y�#k�tqҡn��[�1c����d�x|�ej�n��"z�<"�wu[��g���gm\pă�6er>�e�}�e����p��!�*s�xqkno����y �m{�ym'ha�.�3��'=n�!�iʤf�g$@gd��㈥@'�����?:<�'�5��.�����%{����$�^��c9�nb��ѧcl��'͚���!�dc��x.�j�$�t-�}���<ޡ}� &��t�� '@��.ĥ(xa�� <��]i�@ω����|��,'×�ɧ�{�3 aȥe�`[hr� 2,s��1&o��e�c��aee���e����ӊ1���oyu^�y��`��?et�/>��vg�� ��x�� ����f���dd%eq '��kd�薌�l��}~wd��2�©>b ���a0���r�;ǡ� �a�3nz��bm{��^j�őٹa�w�(d /^��ڥâne��f�_��[|�b-�p�����f;w��$<�y4�ć'0d��j!˻s��`�q�$��=���v�u���r��͜��s��ra)2ӑ���bj��j��u��u�����0 �2f î����c7w b-��h?������w�51�_�@0e&e2xt��,f�[s�&j]s~��rl�h˿�|�yt��ϣ�w�mp�0��wv�f���}�r� �"ʼn~����<��*dt��?�t�p9��s5���bi�k� �����g��vx���<�;ȳjl*�v��jt,.ʙ� ���c� -����8�]��_dѡ�˽��$�l�a�*i�n��aq�8���s���p`�i*�_b���\k �8|��i�p����g�;!d�q 0[�&�䙥�5�h�h`z��) �῎�c.��z����{�0��5��1r�#�ͪm�se���ty��l6�ji "� �n%yz����l��k�=)�!��e����ޭd�=�����#>y:}�h\�f�i5�v��$u�i���u�� �#6���;��'��nxw^��,���g{2)v�|e�[����msg���rk�ܝ�sl�}�,n���vq���m���*s�� �3u.�a,�j!f/�p���|4��*�}�#��n>h�*�הׅ^" j�ǐ�=sg����ڱu4��<�c&d��-�i���"\\�sl����t:4� ���ʞ�bif�u��ݛ�e~��%y��i�p�g��j?��.���!����������: e[���sqm�� �����ti�d�ûo�z��5"*�5��o��������p� �-y������a!�"`z ~�`4"[�as ��ғq?�|�wv�i�����p��t�{��l�/ӭc#c��b���=��)�"����r����z#��&��� �qs�<��0fr�) �@�����e��8o�y_�c�"�&�k�^��d�0qgc��%�$$ѷ<&s��{b�e��3v h���dqjb��-���g��߭��n�b�v�h��h�ޙ�� ��`�;��9o�ς?��0��q�(9�����w������leyp��:�-�a�xp4ɹ�� �a���q&ȳ1m����9� �&u4�¥ě��hbt�bqn��p ��#�� >��ʩ^o�d�ڛ(;���y��臌 �x��wp¶a.t�t|��a1�4�����]�g�-}�&o�x䝻��`�������$fї7f�毛h�\:�l!�v�au���m������4dm�qy��ʍ�x��v���,��^��y��o/�k�8#<',�)]�^~��lm�i=�2�u�g��1��s�e��.�.�ab�c�c*;���w��n0 y6&gޭ6�fo-�m/��!�"���t!�ji$�!��d��j�j���.������������� ���h$e�|���h���&c=s���d5�޽������޼���oס�ں����$��'7����x�f��ױ�����dqd#!����opm ŧ/һ��,�)�6-����p$�8�9,�6/�1vٟ�����v oā/��:.�m��pc]p 7���q�9�sh��s��p�?�� ��e50�w��x�;�&�� r��?m��_,:����מ��n��c7�����t�u��2f�� a�iz����ms�=��8,p3*/y��)ce �����f���}s c�9ۀw,�u�8��\ko�oki���ҥ� �[hp �=eۋ� 2q�h8%�o�;���<#o ��o ��5y���5�7cה-�ڲh�&ʈ��f�l��l6.~�t� l'��ayy(���izvv���(��e~x� w��@a7�fv�,4� � �(���h�� x���3�e��h���si�:vŠ�ߋ,����λ j#w?���~d��>(j��|�h ���ag�z��b�o�f�7�m� rs��q��_u�$ă3de���(� 8^q��ŕ��yo𶱷��ħ�8�.��ʨ*��ji�m��pǂ��щl��/.��o�� =�@���� 3(�cq>l��z_|��h� ͌'*�g�hk�uu>��mr���fyw�`g�/��q����v:�uʏ|v�d7��n�$�� ��;�e � ��=��y����iry�ۡ!�ۡ� ��l��g}s� ��,�v~ض�{h@ř�y7 ��)�5�wm�?�y�ե��fk����k0�����2ɋ ���7%�q�� �wȶ����6:��|�m0�qc��_��*��m�>�\oð����j�r6�u���:ok� �<2�ሱ�<@��`ǘt��_�:òcfy��s5�� *�>����a1�z�bk��b*�b��v۞�����~?~��84�mc�[���y��5���k�`e�nk��9u�mb����[x�-ܖ/p�0!��t:#p%0񎣠3&�g ̋a��%ޑڹ�op��oi!��,-�hz���y�]��x���i^��!ۀx�|��de,�\d�c����v��t���^\�js���8r�%n�#|�)ek��i�t�sdx��^�t���7�emmkg[�q�p�},g̛��n\�j�i��jh'��_")\c4p���鍢����f֗�7y�ζ��vp��d�ʏg-�x\ʦ�[@'m�?�z~&���q%2����y.�����z8<��%=%�h���'�'�؏� c����,��.k��*8������u8i��xy�wx�����l˱ofo��f\�����b��na$�%�/&� *^��_}��n"<̖ĥ'��7ooy8j�"q����0 �dv)����&�㷑);�&�(�pa^��x��m���*y�lx���ay����b�av����zb�v��k������#��m�=o����bnt�w�d3*f��"�u�lթj�χ�y]ds��k�f�{��u�y;�q\٩���2a��ni_ �� �� �v&�ַ�g|�b�x��`%o�hh>&m�q�d�ia��04�x�� �z�u���ew�e{�~�o�jܟ����^п:�-xa0�u�v/q@x��:kik�� �"���x�b/ m�xr����ϐ�� |�í����n��a���jkw�=��]�>�b�͝_��͵yqh�r�t��`�����j�_f���g;�� ��6����gc�&`�tg���ʺ\ oe\' �[ob�b��"� 1�����,�(��>x|�� u�bzaч�>n��u����h?�d�%�v3�d���s�jv�?hu���,g3�ě��o�h�`�l �e�kem&e ����4-0��.g��w�)��'˺z��4a ��o|^�-e��7� �b��`mq{�t�85�0q�zzލ{z�v�v�� g��x�� :c ѽ~c̝�b,�.3b�x��f��a��ll(ϟ�=�|j#ez��.�s3n. ��ng��;3y�k��n{�g�u�栊}������5�t��/����!�ͼv�:����5�u1rm��:��[�&���y'#7�c���{ǒ7��n�.c~l�o�j��7���{1r��b!���/fg���60k��a��猓3g�g��rcdg�wr��/fg��]���c�l��s�(^��qm1�ɖ���j�̧ݩ� ��1d_v^�d��,xx�ڋ�l� �?�a^w�2�,ٷ��#f[�d(n��u���/�3�:���x��gpu��������]����������3�ls�s�[�|wb[0 =:��yc�p6wxon?wo\�h�od63�d$��geg���d��ϑ^2��u���=�gi<�e��o$��k�����o�ç��_��u4��r��{$�xub'�{!�֖�]���ͽu� ����з�9��{8]�a���s{q���ҳ&��g@k^��6?o��e���9���%�'y�� no�k��� v��l�6u �վ�j�bxj����)�� �m���wb|���w�m�g��o��qږ�y�4p%�ip���}r���qc.�:- ����{1��0���!�i��ٿ� ,�t�����<񲪼j�q�樾��-��ţ������ap�z�/�{��3: ,¥�>��q>�ƍ1���&��csxj )��~�b�maia��;;�^������s�*�/�����3�i�4����zh#�{ �d����a���@`���9� �d�)�;�.^1�oy7�ҹ�c^no��yld첤7���@axʌr�g8���nt���nq*�rϥ�/�2�r�s�sy��*��w���)�,�}nŷ2�l��b[t��r����j��n*�@f:��0p(qsl�:hqbzsj.�e�ގ��|�b ԛf�����l*{���p���j�xnl�2��^&|j�ߩ�̻�2����s��nc�mէ����ʾ�f��ݿ@6�ԙ� ��b1.�߾π(.�v�ھ��ݏ>��n"� !{�k����b*o���(� ��y�s#_=z q6��0�oz)�]�tf�*d�y\d{�ȫjt��j^o���pک~����`���ţ�7����im\dh=�mun iy&��}��=m�3l�b�ks�$\s��ē�롩��t�� �jajo vآdv������<���x.��i������~�-ԗ�`[�����8�ۙ[>4�e%Ϳ����_�ۺh����&���)x�۶���;f���` h����g���v��l�o|}�-��en�[����i w�ڣ�s �ơ08���~wx;��]r�5�70�����f����������-�1�fg3t��)le2�b.k4s��ӿ£\�)yu��8��z��ئ|���m�vs8b�h>�g��v}�>4���9��3�o&%^}x]���>0~ �r\�� *%f�$�g�q'���zƥ1$kȉ;ˬ$?:�d>7mo�դ��޼ vӗ�њ�o���r*c=q���&��xs'sje t�f'�yy'qge�m�qg�y�_,�o�;_v?����uf�co������q�b�$>.���,�#w�� тp�{ܖ*s=��"�q�����hl��ba�¤��c �)��֍qe6:r��r� a=�/bo����^fv�z˂��a���oy��:�=;l���[y�]��l��h~ԙ��7x�{ ����z/����,��*���i!��7j 5��3��m𷚉��{�si���*3���z͎�j%w�����y������8��a�7��c]����y�mun���ٙ��kzn��e_no[%�:e�jp8ǣ��8�� �̰0��ԅ�h�'��aȭ��8�#�j0��~��?��xn!�x:�$󍳡b2i�|<�[u4bc��o.'��xvc�\�����һ� �s���qjc�t��p�&t�k|foeq>����������և�y��m��!uڻ����~��#$ڢ�<)��/q�}ąc1> �@չ�dbu����7�a��q ��"�\ ���k�-�̐�� %>xr�i-!���7�qab�v�窾?������ �}�[!�)�mo�dr[�oe��� i���v#�~����cy(ztfec]5�>�bpfd��&b jd<�� ���3|83`7 ܛb��ː4y��?w���m2^bn�.�y}\����oѭnv;���e@ĝ�qs��z��,c�2p^#���|�� -�o7xw%>ە�g�z�b�a (�w6��ӡ� zv�9�j .[v�xf�d"��f�t�ns��*��]���!5�2�!|�$}b��1�j�>s1kylm*�*������oecȉw �;{n��^�����hq ���������w�l�mں��ܳi�t��c�� ��&c�xh�lra����� ��lzű�/�%�?uc� �z�(dg�)� r�gf�a�?����4��e���#ܛ�o꧍p���uu ���âi� 搢� (7h��v#5$*�jo��>�c6�ϗ��t!a��k} �u�k� c$< �5������f��!�,���#�t��oҝ>�*��f��au:k�?�lr0������]*a/8ѕ�3/���:a��q��/ n;�u}��h�h����h̕��r2��{ �r�i@�|j��'ӗ ��vy �sse�m��_����=�{ �x ?y��=�ff}�qci��8~���l�``��1�w9�wrm��1�����j������n9c�^t??�&3�g�d����hp֜"���9)ֆ�d� ��6[.� �č������1 �;!��ip8�i�p"�y��qky-��iۜ�����{g��g���5%v�oq &ք���:�zlm�5�m�q4��jt&u�u���46���t��r� �0>%p�b�(!,?�ˢ��۞9ht��n(m�:o$�t�w�a���9��/�i�@-�#�����˓p>o��h���1�^��"���f쎯�u8#��-� ���,� ԕ0��&e5�з���\���\�q����hv�g�,ftp��v��#����p#=�'��ʼ�~%�ay���cv���c���=4� �%o $s��x� �ch��p����~[;�5as4�?"�w�b�9�@�!\�k;lb � �e{��l�ρ|_� bj@������!@nm2p�ulzj��s���e����b!|~~:>�??�]e�rt ޚ��e��-<�)" ���[����a�l�0�*� �vbc��f˸���ϥ�x9>%ؑo��;�%" �������� ����lk�d�h���4 �� �ϲ��)�i}c[ei�l�ge3lq��g���g�t� #z{^;7#����o3�2���6 g��dj��5��� �n�*�@���lw6�4�=r��mdd�i�#a��`�zy��\�lƒe�ńg��qj|�1���rt���94; �u�'��o}�o�~�z�0`n���o�m�$�s����i�$��y#ht��������f��7�@���vn�3�h���v;n��k�נj�ӗo]l��x���t����υx�[7d7�ԇc��-�ok�gj�a,���,'ƍߝ�4@ �� " �b����m���ngbcsu>��e��.���[l�ϡ@ǡ�("m9ƀ���d��fk,�e�3������p�i:�0�j@�x��sxt�d�,���%�k�b�'�5jې׽���e�* �o����k)d u�`��:�c!_o� i1� {sf.h"t�7�څ� ���2emí�nxn����i�x��ء����ɨ��x�w��o��`� �k6r�=v�2�ϛp2*/����lqt�$f��;��d:y��� ��<1x����y���rkc��9���,dj� ��8hatn[[�z�����%�{6���׽��=[�r��w � q�=�k��4�`�t��u��bj�ǎ g���.)u�r꧈��?�w����qsxql>9w|����e?b&���p�7�l��l�?n�]%���:]9�� ���q���<�b� c !:�ʑi���7-� e����hj����9s���l��6i�om2l 5s��)�.��{�t��f`y3����ě/q>ew�2�� flv�.ñf�xl��e=-���"�=��6� �2�����jm����3���c���ʲ�m�@�p �iyr t&�ϥ �h� �>|b�� = �ݻ� �g.t�$��)}�s"�e������@!gš7c���3�[���#�iǿ��w�0%�x:����g���_3�vmz5w�|9>i��x�c��z�i* a���4b�e�����mt��j �[�#�| l���ڎ�ǒp�l_�t�2�]k/l�� �a�|��#��l�u���ϛ���ho�q����n�?%���u�,�gx�0%�/ծ�\�����a�aâ���aʲ���y l1�;���d�w�n݉r��3 qh���x������@̡x���� qs�õhu! �<ƈ����իa��0�t����� ��[�` �r��5w\!'^vt���m�uy�atj����a=�bߑd`2�#���d��h�d�lgk��խ�k*�w�p�؋m���&�q�w*q��ެ�h�e��[����m�i����b�#��phө%�n|n�h�"���x�?cf����\���|��xcϡt�]�%�1�g�u� qu�=h��� ���&"g��r |��댄�ts���yu5�d4f3ûy�h�fg$}e��e� q�.خ7����i@��γ4g$����x�(�ǝp}v9�ڧ���9gɻ ��ë8��t�գ�efw���f�6��^{υp!�|iy��8�ףh�o�i؟w�q\yn��8��d�n����!=un���\��m�h y�f:�q#����6���(`�0����q��y��cy��ms~|���_h r,�������̎_�[%6��sm�pw�u��|�����4m�b]�h�1�gk�{��6������b��e���̯>[� �{�����9�c���az*ܥ=vø�>��`��`���.�@cpcw�r��b�ƕ ���ahty.l���r�!�}_f�s����b�ol;{2�p��ps�͕$�fҍ�1�~�:k��6ițt�0�iw��i�1m�`{�k�c��,�f�-6�s�%ǽiv��h�g,-��}��d h�")���3� .ɳ��0ns� .��ap�2)ԓg� �^ڏ��n��jlq��x�wblz�̰��7g3�����b�äe�g��2����'fΐ��,�v?�:�� ���i�y������ ��yճs!^���o�aee!us�s p�䫪/q����c�%!�q> n̐e���b�4�rbs���e'�ȕ��7�w��xl���z�nex��`j����b�{d廌�]�%]��:��y4��ʹ� v/��~jqnե���i'_��w�ׯ�`��e�w��¯e�lkau-����z�o;|.l�'%��)��c�ɩ�e5zoa�#�l� �m�i� �m[lg¬�jl��!9#^d&�m������{�dwf�^)w��`q����y�ԓ��f|�8���� ��it�dl�hm��fmgt�*�h��$��=.:{p@-v�e�"�dx/�ݚ0!���r��@�6��h���.��b��}�*� ��9�wu��x�~��躈�o{0��^���ϡ���b�vt��y��%0u��m��հ����p�g�0��� �� _�5���>�jxmm�v��2���;��*�]� �,��!����wm�2э-ph��� �}�� v�˯[��?j�pv��i?_�[�:{į��e�x����4�j�˧a���-z� t�� ���$�f-�v�7ٯݝ���s]^l��iv��8]s�s ���f�u�bmc@����e�j]�ϋyt���.s�늺���nȟ���5"$�^�����,q).����lj�9��x9����azd�u��x�����je0t [p�z;�!��ĭ���r�j�|���*��]�&�� 4w����s3�묌�:�ojm�kl�u�����n��-�ǟzad����ݾ���#}�d?k�8�s{ �����,���cqb���8\a�dx�� ���໸��rb��%�v�)e��|i����ѝk����؝�(l�g4f"eu``�҉�l�cvw� ��rd���r?�r�; �6y�%������b����1p��n�v�v��0];�xjp?���;��"��o��'���^���r�!:ʈ�x5��z����֛:���õ�>��<�.��u����[�b�e�ah�,�������1$�::d��d���c;-�y��f��6��irf>s���w��ï�j�2yt�t��)��0h����w#��������m����h������ɼ�uga1���[��0_ғlu��s����(�9;ly1�&:��j k��v�� h ��s% =psg�;m�*�u����w�ڳ��r��u��������zv�y�g�,hy��85�gq�iw�n�e��۫��'i�ey:�c/���f��͐v�e� c��xe� $6�jy4�8�v�ޖnm�/hd��� s�<�ni��� $�ޯ�p�:��� ҷ��r��렭,)��vh�dqx��ab>b�%� v��i#�=�sh�ĥͬ�@�v7�j�8\n?!��t�v�:,�no�t�9�0v[v_x���j@��c����)�v���2�h�r�\ҏ|_�u?�={k�̿�v��v�ϟbv��.��y|k(l� ���"�v���� ��9m���|6z����:�b?�}�~=�gd)m�x��* ��k�σrz|����خ2;��"p����<�g����*n�ׅ�<ט2y��|d��k���#36s��m� ��r͙a���i�`tٺ:i�4�0iurq@ntw'a�f���:���g��&�r2�����ln�f�n:[^�q4�>l�1oύs��i��������wyqf��}1.u1���ca��: 7 j�zg��2����?a�/��e�nru�r�u �.jr�����a$�ψiw~a���32g)�r�,t�h�}�(�j|��q ���� q����g})��hy�o1w�\l�$%rc��:���u)w���d���.$��l��edz]���m�ĵ��[��=�0s��-�4:��o ���n(0l�ly�ҹ�ى�>��v]�9�����lj䁌zs���� #�4�q����r��s��%i�4�dq���@_�zo��nm4�ƣ�����b��қ�d�dn��2���lg��n���~�s8���i�(6rbf���egu����(nu'c�]����i8����_�h�e���lu��x�a��׷x�s1%m�� �z �������;��mk˗fq�}�/a ��ŕ8g��*ί-�&j )�z�h����㸊�l@r\��xid��sqjl������ۆ"}9d����njrcx�re(2�n��;�im��j��-�6�c�kh;�/�?d4��f�c��`j�[�}�kf�6�cr <�]*� 6��t�,?†���/�qyjbva� ��s$b����fs���"��8,���h�m}���|igڈ�g�`ӌ�f1��t�����t:��ju�6�_g�]kw��%���h � �=�v���x��j�:c�v��f��v�smj���*��n����ti�9u�$b�t�/�]e� c0�m��l\�c�(7x͚c��/�}i>6�'��0�1�8�2vv`���|�ˏ~o�\]���}�#�d~�fhd�&�y�rh[�f��?�m�%@e��~��)z� �q^��7/�0u���֊�8�f�8]�~<^�%h8]͜�^��cs)#ncf���0;x��hj5�*m��l�׋u5�� �8ו��e �x�k!-�%�~��~�ɠ�i..1�(fo{h/b-�������|\~q^@��/x���]f�����w�~�pij%m!n����o��n<ϟ�n�fi"7�����g�s爕gq7}h����pܗ�$7�o�bl�����^wm�^�� y�#w��s�wxz�ǟ_���<�p�gs��_\np����u� ��7v!e������#�}$'�cg@�f�#;{��ea��n1��-{��i1�݁ �ҝ����m�ނ/�g�*l h��z_���@�꣧<��hّ�k�t�c���lw�ٯ�)��@�e��_���j�h��d�g�g�j�l��x�wun���w7�b������l�n�v�p�_�>簅 7߶� jr��lؠo {�{��*�s�����ˋ��e����n�ǡ9t��tz�f�)���3r_����w��f���fp�� 1��;�]���7��dw�54�gs�r2 xy_��c��w�5y:���u����lxn��5n�;� 3��fw":)��n(����0��2hf9 ^=��8�6g�*'�s�ʒ�w�b�@���f�f$�}�]�\ln3�_��\y�@y%s�e�d{�b<凓:arxhq�m���o������n.ptq6.'�ć�!���o�2 ԅ^��.vw�8�*# )��܅���@�}�,jβd�<'���y(�n�p%췍׼w�ӻ�)�<�� �/��b�詣���h���f�v�����j�~;[��j�q~������2�n )e�������u�u�k�e��]�4�����la\�u�rw0����t�t�pk&"r s��<̴�h>�m�:�����o�_��i���t��2�j����s�zpڢ;z. ��v���%)e'��fp��<�dw�䵸8m�ٮ�z��b�(����°�c[å>���c�;����|(v�ci��v���%�̖f���f� kuփ��̶ ���h�bn�zc��2��z,|����4�4�k�o�in��w�ף�u�~���9!�~:na\":�$���e;��7����/���wp� ��|�1:x���g"���� ݕ�a����`� �#�mzl]���艤뉯8=�yo*ѡ��@���yl�[���8��d?f�г�no�g�#ĵp����#�s8j��|cv=<3��;�j�a�m�r�[ g�իլsd�i�o��崪����� з`�j8d`y��ne�� >k��5� 0 ����ds^� �k�b��x�"��a��o� ��j�\|ڞ��jϡ�%l�b2����%���6^1����5<�b�|7��y'4����i[oo�k#������.���0j����tؾn� 6ǣ��}kql?�}8t�e���z��y��\*�oit�!�}0d �jw�ݚ�ɭ ք�a8�nr�=������=�8\�ix�4���'�{� tsu�n�q�&pϗ= p��v���g��_6��i�ب���b�ѳ>��7�v��|(�?�x���<�}kifc����ok�f��v�m�⺵��3�e�h�z�j~� �d�$��xiu�(kb�«��~���%��a�t�h4&��w�� �h��3\�n�ր� s��j�]u�uuŵ��wib��,�ţ�y�st{v�κq��2e �����]qa�,��^�a�hl��v�=��)"��\q��9\α���o���}�k7h�94u]��t�*[`�1"޾ꚷ�ւh��������n�[q��hɸl"�kvw��#��#߻3�g��o��]/���d`�,ճ�ͮ'�lw!���b|���)��:�d]��yvr��t���^��|r�� c��с1un�=k8������e{z�d�h�!�7�j����cѧ���;=4q�q����ûmk�v�e�lj�ؿ��纕�^���%��r��p/i�s[�7���.ڠ !\�}� �¾���&�� e�ܪԉ#��e�v�i���d��g�p�' gk�m֘k8�n=ș��}[�ɛ�ͷ��h��ᴋ&a�\�?%���[/�g�5 ���( � "�@=�� �gƴl��c�6]n1���y��n�b��e�)i��?_�bag�`��tm@l��\����p`�1�:*��i_�ԁ�rob,��k^���>h�b�8jo��h�s1 �u��/���a�j=��l�,�m��tu],��&�gf1zf�zj�p�ދ7��wb��!�{���h�%cr����vh2�ss�]��z�hs�i>=bmpk�`�8�o�s�l� ��~� w�q��s��5_�  mm�¬�{���g��e���h����3 ���ⱥp�l��6x�[�ų:�!��;�.�e�z�d�ij���j۷�߲:q����иp7�1bi�c�_e���zwt�t���q>��iu�_�m���r�����p � �g�t�s��0�\��dhb���_,t��������mo��ry������j(���5�j �la]zҏ0�-�ȱ6lzi�*x�gʯ/m/:v���.�nf_ay-o�����֮���љ�m�" u�k�s��������mc���zky��x�z�d7���f� �щ�o������l_j��w�%tг� ҕut��gf��,ir�8*�r8���� �ͬ� g� hf�����1����h���ѹ�s(�(y��g� ��u�r�['u�㚣�v��lk|ha����ԥj����k�f��ɣ�t�i����n� z댱��l�:oz���qkuv��m�� �g��t���{:�#�d�q2׷y��cocwv���?��om����(=v��c��j�v�b|��r3��k��<[a��j��b� ��rx529�k=����9�^:�i���d��/��s������q�wtz�w�u�k���t�·3�}�x_���o��&aoʡt<��{n?�ݡ��g:g ���ri��a,���e�b� 6���\��.�j��.��꺳�'sq>�1�c/7����]^3&y�q�,�8�%�d@=�ҧ�͗�hf fk���i����lʀ?`ؑ���,�:ժe}q�q�x�[�=4��n��m��r��5���b�[u_���t� a=���i獥��}-�}����/�qs�yc,�� ؎x���biz� �k 3��g/ݲ��0 �!�pcr�5 ��� t��!e-�d׃ �fו���ӛ`����1���s�&v��pz]�z'���̽a�{�9��u��[� &����d���jh"���iy���k��5����.��7j��o����(�p6����_�b㎗�n[���á���r�1 s:�zu��y���a�s���͜>��h�xݟ� �� �#�2?����w�"gw�p�x`� ���4�kk�w�s [�hmz���(��8�\�t�|f�b}}�7����>�?w(�ܪ�@q�a\l�d�$������=x�����f��x�b]��c]`�/�\�[i�� n}��0��-���#u��1dx�5���$�/�� ���o��4wgcs"þnqbįsk��~��v&e��3j�u�ؑge<��r_��ǘ� *(*!*y��ɜ�v�=o���ܸ,�h��v�˶���������/�� d���r{��9ǚ�� ���])t��⿉ 4��åb`w4�����n��!�v-#�g�����^�-����tۖ^^����qm�����s��i�3�z֣���a�2i�����ji@y6���s�8���3@��k9�ch|b|��������x�ož���ol��yy�7���9s`�`���?k�‡ы���lk��ѽq82� ��wʩc����)��c��s- ,6<� ����d[� ל�wwl��ȧyqo����`����#0ݔs�k $�ɯon����_�����dz����%d��-v��e�h�d[���֌wgh���]���n-v>�f���{�*� �,f%��2���!�in�b�[/\��oscj���ex �-�?�ȱ�eˌ #u��#q�2!>h5��'s�nw:ec�8h�(e��c@�_��r���j�����w���d|i�j���n�uhoaok @�w��@��7��j_l ���4� u����t��� 3ls�w�o��'�u �?�똇���c��>2ͱx������o�_t��}�rm6���^�1�-׆����dw�bl��'^�ء�߲���{��}�f�/���-$[q� &��q �[ c��u;�(�ո��=��k�r�8գ�mmw€����˫?��c��� ``�-vu����[55�=� �l|���ɂf_]�<��b,x.�o�� y�l����ȵ��[џ���~k��#�)�:�������!)��p h����5['�s��ms�mт�~z""j�a�����l�η)j�iaozl'z��^�9�� ��&��6ͷ�_��r�?2�^��j�p^�t�gwq�]ӱu�?a�]��h�ð��(p*thh t�� c�(�e��v�����m[�l:���*~�q�~¾��>��xdk�~y�j���w�ƅ\�m�t��r��;w�,jщ�z�� ����$�~"bc�e�����a�q�qum�︦�u���ӏ�7z4�i�sb��m�9��:3��?w����6���g�a���d% nń4|{v��_6܊r�:��x v�@�>i��$���c�?4�n)w������:�^#�ǎȭ��x&��ěn��i�uc��>d�c�2j�i��ޟ�b�����p�����z��1��e�y��[�>�k��%g��6:��������9�pd�h��ha�p ւ!��ɬj`u����pq��7�h��&~����ԟz�!��.�l�k�m�˧"�qa(��j�s'��x���d��.�h����d���8t��"f��zg��\ޤ����#-�o�ie�t$�z��� ��̡ ��gn�9zt[nɨ�h�r��%z`ix�d|~���l�%�4\u���g�r(,��ed�3c�hm&���s�e�u��`���� �w��vxd> }g��ir�s��3 7f�ʢ�to� x���s2�/�`?�n.����`��fa׀�b�v!� ҧ��hۉ���7 �t!��e�xtx׳��dd�sv��h�ܢen�|��@k����@|�-n�'�l�7��~�(���-��a����~i�a�s��5�e�����) �tff: ŗ>�0�t�n�m�q���x\�~��j ��q�,�k��gp��>|�x�)0�p���������m��n���(��9�z��s4�&c� p��d�����s��:}��6�( �f圤b����)�]�'�v��d�bp�;�4o�o�kik��v�0g��y�yҗ���l����b. @8���xy����o�t�n=�w8ӧ�%�z^�y��l�w�5n2��b6�\�u�&#x�vn5t )����=?�wo���m�ш�f ��]��d�n ��v�2��,?����iik�ڔ����;��f}����m�ƃw6��-maq]�s[���k�����*���v� n�����׿q쳽k���z)m�٦¨�� �v�ۜ\{u 0c�y��-� )�?�v���a|[�j�ɂ�q�˃�{��,�4`na�|c* �1�wyz q�<5(ٸ(�p���� js(=p�u�1>c�"а@! �ǚ�� s�|f�� �h���%^[�گnպ-yh� ���e�b̮�"x#*��u����ns}`� ��of6$4�������%���iǐhxԑ�a� ���i�����;��nu���lr&le �x6c4_ �|�<�h�� 'k���yd�s�2=��q�����cz��� �m&�]�[ �8����?:w�^s��)�uѝ짟�6;e���p�'���&]f�x�b�,tɛ"��/v��a�~�#e��9�����wof6qf�z'��h� ��.������j��k���۠�� s5���b� �k���q� �:�}�}׈��{�� a{~�^#�(f�%nxd���z"ʫ]�b�t��?���h�ܽx���߅}x8h���^�.x�/�������v��nk^�6� � ” ����j]6=�jn�m����$�>2��>��8��wl���b7�,|c2t *t�<�6h �aj�ܑ,3d�e���(  ��!�7�r_��ĩ��`|s�?�(����/�a栋z��s�'�$b! ;vˆ~�'��]e�bp8�lw f��^<ټ���p����=�;�_�@�0�ƒp�������ҡ�js���@yw�̒f�x�z�cj̑1#�b�;� �ȓ�d�7�aл�-��l.p�r6ͩ��wg���gf`�w[������0d#��/a˳�g�����f�fd`k���t���pk��g�o���"d��8;� v4� ��[;�$ ����1���&��f_m����<�����w[ �i&�e�o��`�9 �h�k�v�21�z��_w�u����g��ƽ����� ���q3�x��d72b�� ��&&�v.&ֶ�11qbbr2"��<��:v ��_� }����d����d�"$��#ӆ��qtco�(6�����}.x�`���%�е�lz� �m̡� nצ��c]���z��ō��������x^���fi�_�&�h�đ\�l�u���t�n��h�5�h7�x�7�г�ob6���6�����6��ˠ�_hb�׏߽�r)����'�:ܤ��rj���q""-m�4`��-e|�3�j����d��� ��f�k��xj��q~�����;%'�ieą�n��� !z��g�8>��e�gr�.c���3�k窽���ġ$�m��ѱ�ef�[$��h��?�g����m/�˿ �"z�c��w��3$?��k��h)�� mz����ɨ�b����"���^9�y\wo���$����-���t)v#?^�wm�l˘�"�a�!�i-6�]�/�g� tf�ga׏�v�� ���d�h��-���`�cl�}둄�&sxi �y�z�����a��nygew�'s $ݸ��m&����ycg��y�f��.oo r�3k��‰(�l���gv=�ex�l��p ��f�h�i� �,`m�pwq�����m��!t�ǔ�χ{�1���z<�:��� �6�g�u�v�����x���)#]�j�m~�5@��zf�l> qv��i��g^o4��su#�c���ƹ�ҝ�^����;򢍆��b�}(�����:���_gx�w�����վw\�)�d��� ������d> h��x#�\��a��h�q�9���ѽ���=`��ckunno�g�� >{���x����_ݫ1�#;:m�km��7h���}v,$�vv��n��l1�i��r��|i�f֭�bn�}f�)��/ &����,h.��'�4*s��_^�p^?�>|�7�l��n�|ai �]�r��� �z�5����b�>^��c�u��ouro_���w�k�q�hp�� �����9,��`��]�0�����q“%��lfr�gk���a�lǘc�����b@)��ϖx�$��dy�uc����^"�sr�,�y� t�`tш|�x.�%ik֨2���4`�>b�� �k��y_ s��_{��6fux- 8s���iׇѹ�=j5�xs�����mm�ޘ �0�y�զ:��ڝu��"z�����gɯ 7�j&rx��p=�b�̴ɗ� ����_3������������x�� ˓y�́��j� w�:�p;٭l��h�/ �l����;ޟo��md�2ȹf�����j�j�'df?�l� zr���b�)��86�� ms� �)��x�b�y���0���l� .�iv�h�ͦ�.�e�eo���[���܂���ŋ�'is�n���l_|�p�-�r���wh$ ������ �<�z(k���l���s���_yb�b��岀s4��´l�l�r���@ʡ�q%[�j���<�mm8��٤�v���#�e ���a��y"��hz� ���n)�ӣy�t�o&�e�r��d�bbѽ�x�|_�n~?���mì붦۝o�tmm�� �8��h.#�rs&�{cjԙ�6��vmx�i*f��pz�;�egjr�;������nmi��0�u��x�3�`������!��3qj j�˜�.v�u����[��oa�kcu\:�5u� �ڭ\���1��a�b�{��t1��`���ò����kf`�v8����f��|�����>o ��z�}���h��tv�o�rk�ĺ�� a��fz!���q�����zq��jd-y�d�]&mp�rv����x���p����v١����ۄ��,��0i�����nwܗ�mn�����g�]:� ������~؀�n��~z�?3�_}����__�s�����u�i�@�=b���z�s�z��0��'��s��\ ���z29q�ɉ6h��h���gw|�u@��ԁ�b r��$��e i����f<ħ���?��;�3"6 �*ʿ���re����e�bsk�%��o�~s�yoan��)0�t�n�*�zg�ݷu�e����u_g���"�\��c�1�dk ] �e7��ek$��0���ea��w�@�r냦?��y�imh )_�?��1��c�pkm� ��p�f>e�e����ϗ�'iz�h q�bo���t�k�,�u=����v�b �wl��w!�?_d ������y8�v2 !�'� ��`��b��i!��~���2�d#�z���(��m�}�w'��v�趔�x�bݜv�s}dp�<�y!{���ȑ���9k6o[ǚl�3���2n� 3�u�tb(�.t#qb�9 ����. �] ']|=c leɦ{'��t�y� �݊_�`��q%���c#.-��ipɰ�o?yl�!�k�x,����|��m�}a�ϋ��kz�=m����h��*ߙ�ޣve��<\#�����r�w(t-�`��r�*5�k(3�հz0�y�*$ҟ���9�&���x�э�[2��3��t�@�"�q@vz��~�����m�;��o��\�7���a �����>���`nf���2��/��i�5� b����1�m��p�]�o_��nj��ܸ2]��>�7�=��q�d����:1�rs}�i�{��zf~�p ڒ_�.3% �馛�z�p��zɋv��и�h%��f�n�v�!i#]��q�o�*8s;�f� j�0q�l���ʊ ���w�l�l�q�# s}{���^#�c�:yw06����'�e�a�h��-���sh���`�"�����/w��?$�d��f�$x������tf���h�2 �$��q0���m�g�j}_��^�����n�v����%q�����{�ᔉ� �����y-�ïþ���\ѻ�@�� (v��a� �f���k�y��,p����fho �� ����h��!��q��v�р��4הq��>�ے� ,�o�or=!5kx�d�i3�[q/�� ���%�����x ]t63z%x��x��(���d���b`!m�-�0��|��\z�閑>���� �kr;�@ō1�#v"j��d �!c��*b�t�шn�t� ��?h�r�߳ �s��� 㹴,�3c1�jpgu�9�r͢�d2���m����-�d��|�r ( 2�t<"fc���b����as�����8��:l�ܥ���/�ʁ�s c������n���8btt s�[_y�x��e�x �ϕ �̎�����h� ��s �e��xld0c�#�:h�β������4�/�-{qqgp\�4ug�:0gs����)l%�m���{g��g�� ���}m�2 �r�s����߲btj8����t ��9�����5���y�1����h�(u�^^���^\a��{�tdu���z�k֫؈�)c[����1�hy�y�.ж:���^�n9x1v"�6pv���h��1p3�2�!��#ѱ톔py�h�@�q�hn'�}ywǔ����btnj�o�h[l�4ǖ�!�m�4�搈0v�4�9�tbc[ln g�0�� \m�fm���u�� bi�{� ���|x_���g�˦�[�"��9r�8�_ι-������̈�b���is���-s� ��dh:4/���s1b�zke���=*�d($�/l��z]�%5�렎/�f�;�xdg�:o6�mtid��%��\���ܱ6���n,��|�<��r>��d���<���#:f|�ܯ�����ll]�zp[~ѭ��$����j[�ϋ���ӻ�"f�j$}��t e]�4wf2s�z /<2ϩx?a�)�nz�j��~cȭ)?wxm�i��lw䯵�.�a��h����5l���k�p7 �k� k�����/cg��[��!�j~y���[v!�2����ev�f��f º�˞�uе �p<%����d}��"k/����e����<�jޚ9��j��?b ��i�kz�0'a4l��pv=�ra-� d1��s:m�/w�v��i~q�#�o{�wɏ�;#�#�kz3�6�|7bƕ���� ����z>2x��mڜ��*h"ϫz(b�t��v�����h�;v'�����2�v~)s8y���п�%��x4i���n�wlhjjڮ8t6qaf:c�_�l�y��@[a6u�t%@���2?�.�x�۵�z�ya����>f�\��k��%�� f��۝ef �0��5�t�|a\y3��x)��*�s,��f�'��e�nd�����xqh��2ʣ�-�ٜ��k���q�1�tj�e�v�5=fd-�2"' �ouyk�t�eͥ�-���c��^[�o�#@�~��<,h`�<�hy�6�ښ%$�n��p�)��s� ��ppw"3wx/.j�ڞɖ�2�q&�'�� �a� ;�\n����ag1;�҈'�����q���u�i!�t w�e�r�d�4zkshn��e�1�/m�[,�;iivm��jē �kg�摕�-�f�svq� �_/�� �]i{k�(��c��l�v۹y�[{�!-q�<4�n�޾|�j�*�]�'s�͠�ީ��t'pi���fcq��7�f�/*�&o>"(�9!a�6�'��b�w�of�9(hٍ�h���b̑� ���.� ��bn*�okv/}���7>ƾ�;luz%�\���t�j11�%s�4�0�ot4o0j �j�zo�d��y�!�x��\�c� [ ?��\ty�ez�h��gd�#�d�rfx�dkk�i?"�ȝ�ձn���i?�ee�����s�e��j ��lx�c"ha�s|(ʻ/ ��t�c�b�%w��t @x8��������o�wz�jm{h�����g^��w�����p�n� m��x�e6�ɴj�ʓ������ ���$p��$�725k<ie�@l�j��i(�%���ljn�����ϯ[g݇�c&�noe�i��e�ȭ�&h�\8!>�x~3���h<�[����!�""��섗2� jf)��d���đ��z�&��g��"��@��k�x�����h�y��1�u���0��"�s���� 7���*�'�����l�h ���-u���ozf�دbf<��?�ovn�������1�p��b�9w��pr��e���}�7a�&%�u��y}|�y(�dž7h�)w�"�� ��q��cvp6�:� ��)xj��|��[��'% h���umom��@�-/v���`ڛl����t��k�^s�% �bɞ�i�c�# �gp)>gь�4�g,��j$b���@ꢺ��:���a0lk���鵖��pv�$���!ĕl�}����~�a/�%�s-p=g˵�i����g.'.<�(�h���v9]���d-?1�^9=��4b��d���j��)=�@�����cd��`䱕�v�s�4�60�^v��i��|��ı�@ݴ��x\�|�3?/c��m���x-׽��h]:bv�'�y���ٵ�(n�e����]5��#ކ�5�� ij��̯f�k�m��(7��o_r ���a�&��ra��q�um�gp�rf��q����2)�6�-�g.�1��1f j5��5� jw�po�__-�e�����r��ɣ�4���鵔cl�i����ĸ$ %7�� a�(v2/[��� ˅���ם���p^�w�-as���0���>�i�z�1����hj�;� v�_��/ҥo��3��;=wf��v���7�j�wgcؙ��!.��o���ʨms���o�*�)� -�l�jau _<��k�8��̷��>`�=.��%�*��[�֠��i��[:y1fc��ը#3i�gl��ƚ��d㚎n�<���-me�_p�������ꄈ��r�y|�ٔnp���9��� �9�� j���sh��y�b�pd�̫@�мp�� �vp�-q��8�왨�r�]�;d�t�,h�j���v�� %�,5�˦�\,ܗ�>���p��q:0w%wq�b����n��b�j������ss�.��� �(���d0�#d��4,=b6�!տ3c�b��7����6��b ��ͺ<�����4s�l��6����<��2~��g=sf`��9=1h�8xn�ww�^��8(������7,q�o�x/}�۬��í���c]�����k|u�vv��2��}��ò�� ��.���� �g�9f �������2���h�wh�f���o����o�u3���u�rr}��8i.p� j,ү&����eɖrsk�׻�rސ�@�e-�lx5dz`�n��>� �nt��5�˛큱�����v�����әh�/7��#'�%�&�"��n̓w� <��mn/��ĉه��p6i!�u� (l�ѝ�̡ �-q�u�u���b:�(n� �-��b��!b�r�t��ɏ"r���reo�sʔ w�o�t�ſ�:��d�1 g �4��rd��rq��!�ky�h�a���slui�r�.�q� �sl���q�!gf��#� �k !�)�znd]�'�v{��9~�yglm�� ��f�}� f�p���p`/��f��$�ag�t5'�iub����a��b�� ?:]d���x���j^��q��d��������શ��/�s ���ϯ|�/�fc�v�ͷo�q��xu���)��k1_�,z��v��'��]3���t/� 3cþ�o��n\o������'�w#q�|^o��u pbe*n���3���b�k>�2l�xt�̛�m�w�u�߿�o����7��?o�ϯ�?cl���ό���j��w��ɢz �#���x gqݓ6b>�vek�gԃ��†nm�k$<�򼄥&�>�/���[ �s��>�xn�;����veht��d=�֫�h��zl7w�v��>6p�8�b�%�gb�g�@�w��a �'��^'vw�so�6 ���<7¢��r�u�ӗg*��<͗��#���o$�u����$���҅� �ea�'&br�[�j��m{��p��"^ĭ�:�'��.�>'���w�r�9!'����w;�l�~)4(i�&�(p��'}��(�</��9��0a�]/,��^�w�*� ���(��x����z�)�sz~f ��u��9�?�}�2�@ook�b� y<���6�(�z�m�[h}��䚱i�.��8#��,�^���/d�b��,�m4g��}�/<�����4���fj/s��1x^t��g toq�6�{ƍ�t~�����6�p��� l�☬m'�����(��x�_�dg�&������&�� 3�����f��m�~��$;�c��� w���)^�� k��f2m�]�b��x� wtǚf���j�sqq�ee8�̿sʱo3.ǣ��ks�/i3�ݪ����l� �fͩ{x1l�aث&���c����{�^�h�ř �rĥձp#�𰿸�c1��[�y[����gu�d�i�t�t_|� v�t� �$��"n�1{ao3:��ob �����������j��b��v�@��9ś�v�a�޽g9��y���8���x�c���g�r:��̢ifv�z!0hp�� �[� f�%�8y�xg�o�se�e!�����.����3p�=��/�{l]�����n�#�k��e�,ai�o������3e ��nj��;�a�uh]�g��Ԯhî½���d�n��b͵�]=8 a�ʼn��8�f�m�j�%�nwgs�ϝ�niw��a���c�f�]�>�u� �:س��a�p@�����t{�]�h�] %�z쳕���xaާt�����e�أ����e��kz?�d�a� '�-6�l�p��z��pq����� ��� v@ *ad&�n��*-�l2�eou84�����y� ��xa��dz���?mh�:nkfiu: �&2���imzo��j�"-]02z�x �1��_���n!l���q���!�p�n&ս��_"��l���9�ud��ń���>|�b�6o,�]�i-��b��p��/��������ejx����?}}8��u�)!�qݙu��:����au�]x���!!x%���1�8���]9li!_hp�b�8��ڎ5.��cs���d�ď8�c���6��z 8u�$��q��y����h|���&]]9c��{� ��r ғu�c�!( $w q����r i⋇=zwt��9�%�@�p^gh;jj��~w}���˯��������w_]��9dž!����i��0h�h�^o�x>4 _th��/�s9��x��.m!u4�դ���􇶦�}�6n������\ �kc��b���q�����q]� 4�mx���uzx �˿~��o3�/~���/�q�շ1����t�҆ 3���5�*�d�&|o��}� ��o�e�����a��$�ua8����j?��6�ϧpil�/쌽�zy���_>mt~� ? �����a9��?o���;�� �f������s��}5_�w�� �l�߉ �(&�&m' �<�@�����@i͎�* ��m��'w��sm ��l�3d�/���.�]�x/��و��x���i����4r���0����מj���ܭgޯ�d^؁�_ c�p�d��69��.�����l� n���xy`_�>?�$���`7�cs2�&e_r������r1���z[��黏�5?\���d��u8!�n�_��m��.�i��m�a��\��jpq"nj�l^�8�yv�vݻ@>$"ҿ��l�'���o�g�/p&g\���^ۂ�ŗ\���l�/��� �d��v���1r�nw>6x\6q�ư�4�>��e�if���� am(�ga��l�o���>bc�w�9����t�)k��$�p;z�������z��n0ċ�����3q���btz2r&��ka2-d ����֩2�j��;�~�z��w���b6s�l�ޯz]�t*rp#�%�n{ �jl:�`�\`<�4l�f#�� 1&�p\t�dr �� y��l.q&��"�:۷����i�#:;wmk��j�i`��� ��ga~�9뉺�5b����{4��þ�.\~��{к�g�s��d����3�����0)���&i�p�4� )c�ʵ��s�.�k �:,�k��"�� ;�o�xc��ql��!(� g��|�ay,�b�y����'�e�a�qvh���\�pؽeke��j�3y��*/z2�*�����k��@�?�^�k4����ȟ띊k�n���0w/!�g����������y�������e���n)#g�d �v;'�iu���⦳���xjey�� �} 2€���|3?�֋� �}r7�˰v��yi?��� �"��o�~,�l��l��⇯���lw��_��l.գ�6u����%��s�2�^9������b���1�~q�lk�t�]n�l#�t�my�lk�t�y祲��ry*ťbv�nf��n��/�h�[$�z� $�w���m;/��k�h�f� ��z�2�i}]\�ү�h�[!��-�hs^$�r��h�y�,%�t�jq�0�b.tp��z���wiť��ht�"v��[b"h�;���u���iw���ml�ۖ�b�7�=ka?�����1�e��a�3���6��ׅ��" �@ױ�.t]��2m�w�n��v���k1zgk���3�hy*^��{�1�?o�e[�.-0���kٲ�?�i��m;�)���=q�go�'���&-d�_���ޒ��o�n/.i�j�ue�z�a��� |��������ӹ��gt��t��os��l%/�e�^r��q{|w��}yݣ<���9!��a/���3�y�s��u�n�)>ys�muk*ӧm�s'an(�(��x�ct���_�!�hu�ԕ� a m���ֆ�t����ꇏ���n�k���om��:�lv��10��2�gr���;@��v��t���f��bp7�֯�e9h�-v��������ܐ�.c��r�����=�p�=s��r�'�u'�a�a��)�w���|�t��q7 s�e��d4j&†�| \bex6�i֡�i1-.m��xq��߰�7�چ���.���ͤw5j��`�4}9�æz߽��x�}�c5�_~��wrk_���˟�{���(|�ͷ����,��ŷ������$>9�%��}���k��t&���l0d�;ukk� �h���7�ݺ���c�d� �׶l���p�up�&�ϋ" ]� m�zx��w�vit�\�onf�g�%�ܹh�r�1מּ �#&#{e�~��i���� ���\�0k�*pg�mg#zsq�5f���� c&w�� ��rf ż��h�9�ij��4��f�hj�sj��4���~!a�:���z��.i�2x��"h�h�*�2k�#*r�;�z޻�����f��rޙ i݂���v�h��ǵ�2m���f���b���9� �r.ѧ&2dgz1�?,e�>��k��t�|d1ǧ�s��=�j�x<�r�8�ev��ŀ�o�3�2ޜ�"����m $󮝔�";u����՗\�a�x�<ʀ�q�8�bnz†�14�~��=�o��� 6)1i��.��9�zzc��ic �c���ҫf�p�ob�h�qw�q� άʒ�b�l5���{�� ����4d}mi� j���2/���au�����]���(��5�t��x���1�b�u�{��e�q�]��p�>�g���y9;q[=p%s��^ƀ൞1����j\�;�����e�q��]��-����x����~��[og���y�(*le���i�!����c���o�^aˀ����jܙ�ti,x��������7�%�4r����l�ͭ�f���]:�t0��!� �?��2��� �xe��1h�5�g��yh�0}kc�fh��1�(���d���w����[�}�������4 �y�/����k��%zq��n���wė)bvtzm��b4\4g����_2�>�w�u�����l��m%ٖ�4��궂�o&��v���d=�r�n�൬�w���� ��%4�(27mv�ź���7> ;�t�*�lms�{�]徭���;��1�͸$��ܐ(r�k���4u�� ���g*��i�"�?$-�@i�����&k����lyn���cg�]����wa�惯ņ��t�7����b9��&^ ��u{�-�_2�"!����np�da_,,io�.�kz��o������9��te���tv�l�@ty���~$�q2ڏ�n�յ���}���aw�ӵ��f�2vs;���,-�f��rm��|d�9�z�mikm���7$���.�v���vy��ճ�n�|:t��r��������y�yfо�7k��z��d�� &���li�`3��9��ǘm�p�!k~��<�!h�z���$˧�s�g/m��2qr��: �kk,�.#�f<����%*b��l ���ݖ�i�3z�= �w�i�j y�,hx˹;p9l����e|���k�_���?4�շ�/��(��`�4��;(��o�b�:oΐ�j�x����z�i}����d�����r �h�e�������1s���x� �.i �<�^ٗ��j/)�5ً�͑9yk��1���|u�`t�� ���c���q�hz&z�k][�u�v�jg��i:c���b�u!���lfmc)/�,,���4m:���&�q�o �aa;q���l����n����hu�7`ۡ�c��f_�m���`e��5@�k�b�j��n���m�w�ݱ���h*�tt���f0@v��(d,�"��,�޽��|��g��pk mt�s�egu0) .com/storware/ipsan/console/log/logpublic.class�v[ww�"� �bpq ��1ӫ�x���zk�0�`23����~��l��z��"�����c}���wf�]����e������n����?vch�e mr|1�a 9���h�t�iha(��4�#/)\ƕ��ei�]��w4\ǫ*nhx�ג���u�&a�(��il'q�0[c�rvk��%))\)<o(h9f;vxbasw��awj(x��1z.m œ,r'�s-�x��m��n&�;p��yn�b׿c�°��t �u�(��[0rna��� :����m��s_�k_��z�~�>�u~��{cŷ:���:_$����'�8����,��ڵ�.m� \�߈ϣ�5x4f���7.�(1�� ����q��[�k\t�r�2� �.j�r������\ ��c� �s�����x�6��ʣ�b:� ��d�ᙾf%����*~pa2w��ͱ�c���b[����0y2�8?$��� ���ltňfj~n�u��b��0eu�d���qǒq^��0j.�i�:��ws�i��͂%7��t1/�e���my�{ٍ��q � ׈�f9�}v>�{��{x��t9��t> ��b����{��;�a��1�u=�x�l���t:l�/�nȏe�)�n� �|�x�y�>'m�l�6ې��c�c/��/:��]�}��k�<�i'ҫ*h�@ͤ��⮖n��^aۯx�5��v��ik h_�̣�g$�3��a��i�#6�ڑ�zt �vҁ�oc=�6ѳ�#�1��[$i���@m��y�d����&8eo�^�'�4sho�g�_8hy���߰id�.��y��g(z�dk|���/t��nf��.���![�|n���m��������;���i���2mb�gt%��u��jƨ ��gw��<��a]���z"��q w�dv18}q0n�x[=�>�6>�"����y �o1�1�@�-&"�v� ��%@m8��*�j�>l�} �]�z�#>���"p?-�n��3 2s��~h�n�����a1�gt|t��x����d��@�* �:|���i�>��a�p=n� �8�����x!<.�'�s���g��|� �_��������%�����pw���k�9���xr��h{,ֺ�}0ҳs0�zs���]�ҥ`v��v==���ɬ���|��y���\}(i4�wp��j[����>�6�0̍xi�;�2�^a��.b'�d��x� �{-wa8��sa׳�#�c������ .e'�p� �1w;vڋ������4:�a9f�k?�03­��z���v�ء{r�c�a=���#a���g�p�a%�n=e����8�� ��-;, z�^&��u7 ���e#�rq�p�es&趽;�6�.��s��^��)�tώyz▨�����*���{z��! sx�&��]=�9�ǧ��#��a9�'��p�t~��s\] �����҄�h�=;l�lc���c3��9�(!,��ȩs0o7d z�i�7g.6sr֣���,~cf��6 �� m�g�czy{�on$ � �쬓(�=*�֊�4t`�� �#_�� �4�_��0����&i%��̣^8f�2is��vr�g�o4j����k���p ���m|g�w�=z= hh&f�k��:�&)���ih��^8��y �4jxnd�}�@�e�g�������%%c�dֱ�c��_m��~�`��@��j�%�g�����k�~�`��" �c��_i�5~#f�0��=�������o4�'8�g�y��;ѽ��%�������ƭ�o �]wh�壥�8��xy� �p�e���h�0�;;[r����'�y4쀨�k5��n�-s�:q� �\i��w�*<����k���\�䀞�c,�sdۤ�x��h�"��ꙑoi�ݺ�%��҃�co$�����e��v�ce�l�x�qq#��嶧2�1��?�zֳ��6����(kxͺ䙔�� �b��b�2��l��l1����¦[��,[u�썵��쉶�c��3��zp.����k@���ʳ'��/v��f��yf��k�4y�u�pʩ%���?�z&7f�kz��0k �=�i�����q��k�k�a� ��x��>y06f��ӓ��to�}�p��������q$�n7ĵ����r 07����� ���{��y�������$n���m�gr��u&��&��dtѫ��s'em@g ���(���˺x΋�v^a ������v��v�(j ����c�ɷ0�,4��ra�v��ո�i�b��jd' ���o� 㨈��7��p��>xo(��etg���4�8���q���0�"��07���9tfkl6�5y�]b�pƥ�r����,a!��8���0��94�b�5��a1]�aɾs�w�ci|�q��dzx{�f�\��sܮ\��d#��[1o>�� ^���5x/�e��}�a�l�%|���[h��@�cq���m|��}/߇ط�?����z8���.μ�'q�g\?�8�u�����i��$5�4�9f��v�w�1s8ze���z){���裬�g�>���q���� v��w����́ �8u�ay����������� �4�~��ee �y%0ŋ1��5�u���xh��!htwkl��.h��xa<�5@|xy���mj�x�l�~5��s�k�i�_1<��en��o!��'�׌�9��]9��g�b�_��uo��'_���\������_[o�֓x�m���s漫!� ܎z��ϻ����.��@��d��]r/�p���/ݿ6� z-m�&��l��lx\yqu*��b�� "qo ���(��ņs�ս#���q3�h��k��m"כ�|�j��[ ��o� mn���̛���'c\�ձ�x���#����(cz\ƴ>���#����2a�&�fdl������8��2���e!����^r�ww�ösp�d��il�y�� uh�d��:�_pk mt�s�ŕ��4com/storware/ipsan/console/log/timeprintstream.class���wuƿic'� m -�rppҵi�\, �6�іk z*�4��s��8�p�ܼ ���/�i^��t-yq�����'�}p�>���$cc�fϝs���o��g�����o���~l� �rt�~l��injf8����s08d9�(���9,>�e���m,ۄ�>�����x�pxu�k2^�p�w�5�wb}hhf9�d5#��Ꞷ��1#�jx5��j"��p�qe"m=�!#��� ��m��kmk9 ]ci#�y�yf1ը��)z4i�9#�f��ttt˨�mm�f,su2{h��,&���?�t��f�e�!a����j �t��4}jp�$s:#� �xsb�ơ����q��fޒ�x9a�:��'x�r%o�t>7-a:!��-�2�oփf�zք\rإ��!��vh��l��gˆƌzt���vhbfmz��3�����`o�[z:ڧxve��jb�s��hj�by�tu� �tcm�y�#o&ո��վ�����c:8tq��a�n=<�������s��0�� ��#�9}�s���tj5y�"�6�%\��y�z֊�h�lze��af�цs���r����l�'� �m�c�����xoƕ���>�i ���`�s��w��g0axq#��jo��-s���\>�5lkm��ս �ι�s뉮�i�8s|��9ݢz q�*٬�s�e*=1e]�ɴ�����[ʋ�\��<˘[yu�bfp^&�� j1%��r�s��'�6��\͕)�����h/s� b�����kg�k��h��ʃ-��w �!��骱��g��*�6r ӵ���b��vd �r����s���g��bziv�e�*�n���<�@t,�e� �ƹb�os߆gi����z p[ �:�vф�.�e1��a9!��va�����g���9uwӭ�.�t}%]���w��!5%njvtw��z�j���.v�&u�>�t�g�)����\�)ʺ�#��l�p�|kxl��p��,�����} �d���w�en�� 4�s��h���p��z[p�-%��a'��[��b��'$�@�����]�le�d �ny��rd�����wy�rd���l��edy";�b�su� �dwi vo �%��6�2bd�o�v�������<�^ ���v py[k�����@9�w��v���k� x�z�>�я��"��\��ŵ! ��y��%����vݏk���5b��ؾ$׾rq�=/el5n׎��*�f/���]�w*n�7dv�\����qzz�dk��d�:}�^���z�h�gb�cl?�ϯl��؎9َ/�������~#�߉����l%�}n�1�m#u�h �b�x��kf�x mc��4��b���)̂����/������ߟs�>�-�j a���i9�k/�m|v�pf��ui�vt�-��w�($�9����pk kt�s����@/com/storware/ipsan/console/log/log4j.propertiesu���0�w�� �4hp!� &"��������gj1���-ȇ�v�����v:ι"�1<�2�s@��ɒ)�pܬ��2��2��<���آ�ǔ [soi���k�dd�n<�,!a���3՚)�l�ow@�{�����?3ރ|0�v g%��m���5�q��)ke�_׹߶od׶d��pk mt�s ��1 .icom/storware/ipsan/console/resource/images/commonimagesharedlibrary.class��w|gǟ��";��,�i��@h�� �,;"���d���q���%�nܝ�(���*����д�r(p��{�ji������v)|>���������w�n���y"�%. q?��em�q��x'}��>�v�i=�i�y�?�[�s!�o�ǭ������> �s�n��yi�k���/j���/k�j��i_�b9��%m�0`�v�5�9s�1]{�a#q2 f�,x��,�j���}ь>*(�(.��g$}��&�[�c��-h��h6���a }��p2�g3�tf�w�(a&��ɾ'h������s#���dz��xq|_����ؾ���$|�?�z�z��ɤ>���s�dr��p�:աeә�x\��sz6�n&���#t�wj�̔��x�%��7�%b�$��ғ���� �w�*�3 i?�u%���~�h�ё�dv����^?�hbd����_ �i%��!��k��%�&(�� �߲�!i� 2j��1���z4ť�i�q�1���z �s0ri#��1�n���"hu�u k!���w�v��c#��lv]:�����ml��r� m_:x���_^e*�b��������c]z�x��mm�<�\��\�suyw��x&=9јֻ����rp`��u7oe�)f���e���x�nf���ʥh���t"��b�jr�a7ɤh��� �;j4���`�3p�h��3��l"��1xt��q)d��@4��v��j� x6quu_��rg@,���|�f�r[!�o ��il�_gc�&�řd���-ix�ƥ��e�h&=.ew�2�lz�� 5����� �ri���^�x�>�h��i\�n�"� j�� ��mx�q����5��x��f'��2{����u�^�[����6�ϡ,�`:�l���8jtr8�b�no�w�r� x|�� .�j���c�u����n�:%�-f�m�jze35_�1��1s4�ee���x�a�7g�r<��k�g;g ��%h�r���"��p܁�]*�e�r�栞oz3�q�����{`tx�%��4��7*�oy0=_gю-k3��t�g���ct欜[������;{�sm=���z���{ p������az/�/l����b��ա��1�j��2�ʳ�s2<�.��@����4�v�抜cy�o�%�<���asg��,��ep�j4���x� �i�aç�x�� ���!��)���a3�ai�p$}��0k�|���9��y�3�q�y,�p�ý��8��-3�wex5�}�u��t���tw6�� �y����pn����ţ �=5�k:��`uen�ue�k��d�2њ��=��,[7�f�s�Ža���q�%`����#x�f�>�:��h����c(v�ɲ�ͱj6�:fm�ְժ ��g`l �s� *rǒu-n]▍�;g{��ڥ��-�h����c�l]��٥�u��ǟ��"��uy]�,����x��ä1��*ps���20��:ck��}���\�2�ޢ�3ķ�pc� 5me]��j�!��z[�u���x6f�l��ܠt�y&y�,�g�r�ϭy uk3��6$�c�`�wy4�!iڐ#��pe�*��]ȼèt�2/]�侇cg����yշe�"4���!8b����?�=9�d�gq���'v4\wͻ]-�ه�f*�@t�l�;�rnţ����ُ��r7zh#m�w�h�ѕ�͌/_���}�|?�[�[oߟ���2�`<��x'���w�w3?��e�3~x���2��0�g�c�g�qƣ�1��� ə�g��3n�ӌ'�w0΀5�y�$�)��w��?|�g���1`��c��p�ql2�ρ-����%�e�͸~c�2�����0> ^`�x�?|5�'��̸��o?��*��_~�����~6����0~.�y����g���/����/a�r���� ư�����a�z�����o����oa|-����~;�w��c��n����b��n������f�� �w4�7�h�'j�v��|u�����t �pu������`�ձ�e�{��q��ki���տ3�v�ڧor�o'�3"�8a]�(t�v\c⺻os�z}�et�o�1vg�-u�-8�n�i�)����njw�d��� ��ps�h���ox���,igp��h=��~d�g�a���ޮi�tk�w�n��ҧ�#m�#�z���i�2�f��투ų3�oy���s�a�,�$6�3�4��3�я��pk mt�sv;�b��.>com/storware/ipsan/console/resource/images/imageresource.class�y |t��?���f&/� �, $lfmb0d!#y0��� l2qf�f��bk��m��v\(�z� �����em�z[ۺu���ֶz,���f��"���/s�=��{�ٗ���;������9nr�<��s=��:��<��"��=��z�����b��x��seo���y�|�@�r��s=��e�)�a��h�e|����a��"\%c��5��v6tɀ�n��u��e��r6��� c� m��u2\,c��tn�y���q�,����)p)�6aj#��e�.v�e����� ;_q.;���#7^:w�]��:�/��r����<|9�`���9���.`��)�&:]���l7�x��$�s���g�����]��q��q��d�*r�&/.:� ;d�)7_��򇄬]�����5�a>��n��r>*��t���?� _��o��.�tm�t�q�oˑ���y��s:^�?g盘����j&��ҫ"=�x�'� ���1���f�l5lm��w��ƥշ����l�l^q�"�p�����y 'v�.]����k�*e�fr7����5�갇�h� �o� 4�n��z�l�z���y-x�my5x* ��� l�@[c��j���z?h���jj���8����$oyx�px)��� x,~�i���my�z�yuӛf&w�e��챦ֺ� �#ц`/_���������w;͘���on ��c��`� �e�`��'l f�(�������@<��,��d;���p�7fƕŋaiow�=v�. �� r��m�̨iѡh�9� �j�cr�x��d���8�=q�ӌ��f4���l�ԇbq&o fy���ö���#�űx$�-5��<�s�k����ho{q30v�tf�,a��q��zb� ���vxdu��ϭ���}��hkpc y���`�5 �x�ǻb1���^l�"}�vӓ_����"pu�q��43�?w,�09b�r�����:��!��coel�\r���썇"=b��p�l v ь��۷@�jt�3:�$�jc�ƣq�8��1mkc��p���4h6r��)���hn � ����k bm���u_���s�5�fl�d�eq�� /�k;�or��6�qeٖ�d��6`�˂���rz����k񷁫 ��è�u��u�����3���u_�\��_�ۻͨha�(�4r�l|,]y��`,a���[�����bbql���o��?��s;>��qv(��ij�6����k��6$�m 1ta��6^$�"��]�y*ԣ�m��/��1x�v��f'� ��7���(7��3����[����6鶰1]8&c����w�@ʼn�lr �6!lgy�����d�`7lz�dg(=��ᰕ�e�q3��"��8�?� ������tq2�����_��`51����*o�����΄ei��@o�2���; �o� �֓j��c�z�}&(n6�#q�i�f�=�������x�3�5d��(�?�Ž�,��ݡ��bqsb��z;8�܃z�$�&7g x�g%#�#7�-rjk"��if��ζtg����#���%yu<�)�yx� �~b����ڣr��Šhycʊ"aπ{�[��;t�c���e�o� y��� �]�|��[�kl��_k�o3x/�:����p��rl�o��gw@u�3\��n�~�;�fhr7��m��c=%�7�:�c�o���e �>�b�p?s�y�a?���۳kq�n����a���~!�g}�5�ez٠w�]��mߑ�(3xgtos�����an�|m22�װ ��xв�h�a2�8���a��&��h yl��g��}�p�x��>p���1�������� ~����������#�� ��� �1?�,���@[��d�or���3�l�‘!w�e��r���#��� c����w�cfo<i�b�k��ؾ�࿈,�j1��$�fe8�1n6���� ~3������b�m�"h"p�w�ӽ� .i#-��6��i܈�m��v�dž{h�������6�h42ס�9�p��'�[d^�*_s4mbz�ovlc�i11��i--���\b�6<n uc��9?,ő`u_4j��f�,:�����������* z�2fy:����x$���!l��pm�2�i��ma֣�� ��� �⪑k�ŝ|�k�p�fy������1��?:1c���:0ѫ�g��1��ƕ��mvx�luu!ne����?w�>�c(i��p����vgq�8�� a~u��p����we:t��݋��qm�:�ܵ��rl5�6m�#��׍i���kn�������[��u�� `�_q8g^ⰴ�t���b�6�n���t_uhiou4�kf�;�y�p���;���f8�f'ye�3!( $l"椀�u�wkê��*[�0�g��eb����f�a,#c`�(��j4ҽ�#�iϭ:����j��ϩ}�q��`8�e�$0u�(ћ!��%�i��q���zu��� ��r�sg�3y���0�`ܪg'��.�4�dj�wc����|;�c�>�2z�e�<8�8��?��sl� � v�4��g��|�=� �����,�������#���.�u����� h�-��&�}��qjx*=c/��q�vk����&u�v����_o}��~em[��e��z�y��p��>�j��6n�ji*�%��q.�6xv3%��(�s҃ޯ[s�#�-}((g������d���´篝�j3�ew�tʦ(ň).?wp�)�6��s��w��w�` �!��r�_�_��)�g�n�����c�?��u)�'_� � )���?��gs���| |�/��_��x��s�/�e���2l~_&�[�����r�����r�����]����_�?��������x �x��hup��>�ef�z<�ʯk����-�piט8|>v˻��������o���0,/�`ɠ�`��ҟ��(pkx�r�]���y`a��»h�qr�����ª�0y�ec�!j[sx��t> ?b�"z�[l��"j��*0��7��,�=m�?��_�|�3-��b�����.��(���y�q��|k�ng阢��$�a�8>ɦ���:�8%���ag�s&�h�gg���� �䭗7)�d%x)�y4.�j4j��ron�oq4��f�fl�y�� a!�s����|����g�q�n����}���a���� �*bm�#/9� �po�6'4,3k���%p���aqb2�����~�����l�|��i���m�\9onz˜lēq4�t���sho��<�ry:m�ȭa�%r ~���;i/{��)g�5`�0�8/#�q _n�z�š�;��mj�n�\�*�/�ϕ��7�f�~�b�̄a�m�^ap���p)��y�0'�ӭ᮱tmi1 gb�n��_&04&� ���lhon?}`x�h�i{�wʏe�k�x�^r<�-��n�8�z9[��g�[����/q`�[��9|ήc�r��f�y���!*(� e��pv�}.��v���>���[ny q �lr�s> kӎrf����ym^�8��4�}�����t\jdcn\�w�p�ly�2���tft��re�q���sw�|p�:��y�|��;�֊#\b�����}���� �6���r��յ��$ӗ��p��ml�o��}|��h�� ��ӻ�1>�m f���8��� b�.ĥ�(�?s�m� ���'(��� �s��o�� �⳴�o��� �=��o�=| ����ao��4�e���駼�~�w���m��c�{�ψdo!g���$?�v>��|�'�1��r�>�����̏*#� ʊ`���`29��*ft˕#��� o>���j��j$2�l��5�[�l�n9rk ���rd���4.�?`����p'od���-�c���_�÷�u��_0kc�t y�1���]9"��u�y �,:��b�i ���q=--��irs!����m�v��o�j��f��r����y]s`�v�~n^�ݖ  q�s�rg���(�z����yⴀ%����%�`˻j\>��&й[|:�mi���`k� %n٤6"�x'o�����wct�xu�nli��in^����!n��v r� �1hz�hf�o���`zo���a:|a�9��硂�!��@�szɿ�v~�z��t#�o��0�f��o�y�bt1����r�;f:�����^���� i�2���v�b���g"��r�t|��oe*9�<��h�^�d�r�$�!�h&9-�z�ޥ.yok�8&w��ry�qz�v�*���ӆ��� -wc�ct}�j�����$l�x�u��g8��� k�~�_s������dy9e�}�!jb��jm�=�#� s� q���ῡ�z ��t�o#�����_���������!�ߣm0���"� �t-c�dbe��a�q=r�q�٨ ���n�rj�pb�"*i'i��ؾh����!y]<���w�|:daʣ�gj�[y��0�,"��}�^w{zql��n�i�o��*l�h�6�|�d���p��g%�z�m�fm:�h3r���1rۇ�8����$:;'��d�i'���p��߇��9a��%k�y ��v8���õ��lߖ�o@�sjv�oc�az] w���f�z?�����vⶕx|��ޱ�fg�>o� � e��7[r�,5�v�n�����e�)���t��[ќ��&{<�&���l�u'��}�j��bj�p���r�%4g;��i%t�v>uh�t��q�vn�ht�v!uh�ԩ�pl��k �z��n|�vo�i t�v1�ӛh�����tdk��x>��*��!o��k�h5:�3!��'fvh��a�wg����m0�����<�� �9`��)�w"��f{ ��:�$܆�ia�t1d�����)-����d���p~1� �i���k��dx(f1������(�.��*�#��f�؀������ �r�� m���f�xh��|�0k���q�����<�'as��'�  �c�w��]�#>��خs�:o�z<�zy��elk� �.�(���<�~���e����r��h�ʑ����e���;/����s�ޥ(�դ�v1em��r�=ka� �s���xߩ�wk���b��`7�s:��ή�����p�¼��yw7��nx���(u�y���ə2�h�kg)�d�{?ml.g�!� q/x;�³�"��%t/-�lj!�&�6��� �ocj���zd�롔[���1ߏ�������dg�t���3� ����k%.cƙ���*��*�p_b�5h�3�ڵ��m�o���dl|����� %�k}ޥs�b�=�l�'��g���pk mt�sx�m���ccom/storware/ipsan/console/resource/images/imagesharedlibrary.class�vmsu=��lw: ����b%�� &�a�gtʌ��{z^&g���{b�w�op�k�jk�z�p�?aw���ݓ c &u�{��{ϻ}o'����#'�ja�(z؂9 &.��b?,\��e����j&�xx�u���ć&��(�����ģ�%��n�>z��'�u���϶z���z�kb^`k�����e�і��@�䊊r6�μr~]?i� �k�ԋ���������\�a��@?��ݫ-�i`��ņɣ� � ���r��3�b�ڐԙ`eyoj/��'r w.�$��jʖ�p���s ��o:u �y�-݆j��ogv=pz�� �3-`�u��o���:nnfy*: ��x��u ��'�ͪ *��b�w�ƣ(��`6zu�q���m[w�h�2�vy�!�@�~;p �i�uk%u ���5�x5����f�̰(�^|��}q�i�����:��řa��v9�zqi�g�n�r֜<^� �����j��<��y�p"syô���k5��u�g�w1��ŧ�j�@-�-� xou�f�����k�!/�e�0��;��r�3a)-ғd��djt�)y9? rh� ��e�s�xyz��tn����㸮ސ.��p��}�zk���>� hv|^���¹����f�!p���u�.���ć�zyt�� �gol|♆�9���*)6��=4lƶ��̆�ߖ���x��$����d)ߞ�z�(�2���4��\s������"cb�m\g���}�å��l��?��?l����k�����b�'�do�ɞ������<��=zhb{<�yr8`\ߠg� ھ�w�'��b���\� o�m�~���p%=<2� �!2����m����c�or� esf7���4�l,m�i1ùuy?p�f]�l��c�ѷ�g3z"�3�n������?b�a�~����l�b�㮪���b�̵��1��oy����_�2�t'u蒟e��ww$��ķ�=��ѿ��������:7ez��/�g��3?qy���u���~@�g�ض���;x�� ���0�r=q�o��i��m�t0����`f۹�?��i�k����?��g��u-����fq��"�i��ze�׈~���3t����%���~���'���qk��pk jt�sʾ���18com/storware/ipsan/console/resource/images/allocated.gifs�t��l�f�f�����0h�~�;��z髼_|z��ˋ�վs����ݷב�,/>=q����&�}��ٌ�-�k ��v�)`�~� �хf_~~j\�|����&����/4�_���$|�q�b����g�2� ��?ytt@����&m(���pr\,��배�����e���z�e$l*l�.��it���}nj�vk�׮q�ӫ��q�v�w�w���t�`bf��td�pk jt�s���mv�v<com/storware/ipsan/console/resource/images/app_backgroud.gif�vew\m�n�in����0�$���0�;�݂�������a��o�����sk��]�tu����������?�/`����`��0(���� �� {~�]=��a���9���z;���?��c������ځ����a�$6w [=����v��qp� ��ֱ�݇��gb�aç�1�;:s���c���ɡ�w����=��ֵ������c�����}�06t>�n����sg��c��l��]�y�. ݹ����c^��c;�u�a�x�>t�?���{�μ��@��a ��ٻ ��l��s۾���@!����z�߫�޿ºa�ю}h�!����1l�� :y;~w���z�n��޴w��h/���������]�t����ݿׂbޫ~o�{�;t����zݾ�>� ���g���fށн{��{u��ơ7������w�=��o����3���s�z~ǿ'���}�w���=� {焾���?c���7�oo��;z_���d@����#���������a�������o��m|@�}�g&���� �hd�7r���a��`�/��"�ߡ�&�q�w��o�*2�,[$�����rs4�ɏ05��@7��s�ō_�t,,�$�)˗����l�x��l���l�r��d rr�f��7j�u�3�t�ajd�#�f���{��w~�2\s��xjr�� �x딿��d� �k �z�n�x�a��:$�y��!t��y��hl��ne��pһ� ym�b4}`����h7��|�@��(�)hc"��r�%�����7v���7y����vmj}n����br��c���zhۂ������z��b6?����v`.�؀6����7�� j���j%ճ!��e^)��{.���;szzb��&�b�iy�u=��l��n���h$v�d{��k|y�(ҹc�p`��@m�h��z�m�\x`b�wx��h���qfd��4��s{h n7�=r'�f��ִ����'��~����)�@����k��ܥ:�p�b�[l^\h�? �w�v_sς�>�2� c�3� ���{�z�����8��v9j0�*63�`f��۔�d�%���t��t��g ��p�r*v �)����%�kiq��iy����k�t���a3��x��v~����o� %�(� �u�����ͺ!��x�eݫ���,~$�'��2:��~x��7m��ֺ�� ��?[�.��4l4�'c�-88�����z��} �$|g(�-j9��&��lr� ��/h�!ʉ��1 �k��by�j�,��h�d�_��@�cݏ-�@��p���q���q��c�n"͇�,��`r{��ͯ� gs��unj���q����9`�� �i���b�6�_@��3��$��0c�(i*�����@h�b��՘� ��f�r�%�w{e�*�����w�� z١��vub����;��5d����`����yf\v�*3lq�y`ҷ�χ���x��%�����0� ��p=��e�q8�qy�q:_ٻz�r�a��w) �rh�b3�p���hz��{�8:�ɉl�o�ޓ;?�|#��®փ�(�or�#�;���k ״�v �s�&��]�*'^s�f�f�v./��c�܉ծtr.n�����2�i����u��f��zpj�ݬ�?���^�֛�o&"�d:wd�4�>��0��-ō���sv��[��y1>w])��ϟ#j�c'�� ��� e�5a�'h���r�#a�s�=��h����&�������f؄$. o��ҍ�;m��l���l��s�s�8� ar=�a���z{[���xm.�6ҵ�ݥ-.\15<�/m_�cl��ʌ���# n�o�&���=��otk�)�������)v���h?!�t����� a�,(�ש����.ʰx)��͢:�q ���ivr� �������*r� #]spq�����y��.�bꁄ�,s�ߧ%��/j��ƅ='�ǽ�bh1 9> ���`�{/ҫsx,,����m9�3asݘ��h�>��}� s���~���0���6z �5ۂǥ��[�6�ib��)��ּ �ҍ�nm���\���~ڊ��d9�mu�������/d��[}fs~õ��_���ї��|�y��?rx0g" � c�ą/۱�q�y�t���g�3?cc�lu̓�-��aub��k�>q�x�~#`���t�l�ps�xqqw����32�m�!dn�s&���8"@z��?�ߦz;;|��;��(l~��k������rdҥm=ӎ٬hr��tp�) 3��s�c���g�j��� 9>�n`l�hq� ���hk������_���&cx�?���65r�[s_psg]h-7�vnibl�}�r��k�[> .��w����h �m;o!z���m��~ޟ�|�qėf`>�aj`�u9�9���@�j�h�"��,d����j��]y�w�����{ � #��.�� �v[��eé[�,tx��m�a�ț���ñ.5d��a�{|� ���0v� p�j�;3��_y\"�o��:j��"�zg� u��h;�w;�(��n���{b�s�?yr3d���p�c�����?frj��x���hv��ȉ2*x*r~���% p�`�.�c8�ns��h��/c?u}jm� p�]�� pu�ȯ=�2]�a�x��.��rm��@k��v œ���d�9�q"���g��\�*��93h�r!�ԛ���s��"�������5^ $t'g�տt�9u�a�_ky�s29q03ڛ�h��n�,,t��m?�����g�� /��mf/�����2i���e��� < �?z ��y *ܯ�„\��g�x�(�}�x� r�-\l l�rl&c� �ɚh�:0�\0qg��yd-?as �' ��ěz�j�|��>��^������s�j-��ⰸimm~�ꢸh���e(ac�⪘�h�%�z�k�pgi�y[��m���qi�0k��@_q5��%��p�sk��6�.6i�\8č3��s u#��w���$2���qmi�<�d',���k�p��8j�վ�.������/�� q9 s��hh �;�ڮ?����2y&���2�*ˈ�#7[�ç0yp~{�|��e�����{�k6��k�go� /�׫hs�ͷɻ���ć _)q���?�l;���\(³b,��n��w�x:k��ް�9w�^�jsi�c�_íf4�<؝��� x��b�� u��ɩ~�yn� yr8�py��s�i�b�z0������h�3�r��0�mn9��v��~���k&iiă��;��ͼ��q���?�q@@�htp��]x��o-w}]���v���w�&k &$4��-�]��h�޳� vz��~��b`<`ё ������r�1��?\h�'�f ��g�dņ⨸;�b:n �q�r��� �~��u�œ}�y��oa�`�x�p����d��rn'��h�jբ4�q����>��q }|$��4�s�?o�����c@�*��:�x�v�p���8�t����d|���z�f��7 �:� �gla�m!a�n�b]1���"��etb�yb�m[�� ���gcdf�w�e��� � ��!w�o�n�odcj�s� ��c��[�o6퓝,���ia`�9ܬ��������܅�zx��m�b%�v\��&%~(3m2s�g���6�md�!�j #���er����wq5z� �o=����j��c�ݲ�)k�sw��.�#k>��y�c �e����ӡ�b�b���q3�'�k��%~n7f�/6 b��'z\�xg�xo*g�sw7��d���@�"���o�8u�̫>`�����΂kbz�ƴ-g@9����.�g4��jr���pvz�ea�߃����k9ɷ��f ��l�h}d��#��]\#Ԭ�0�d�'��n4�ѽğ|�we��s�z��e,�p���ח�.m�&zj���(ݘʝ��f!��:�" ����c�"ȱ܎��`�3�n��j��f�uvnlb���ɠrt���>p�ޚ��{l�_�6@�d�z�k�2��o m_{� #3�r�̆�u� �hyˊ�c4 l�mo�$4xa��2d�g-�֫ �ܻ�t�t7c���r�p[�����j�~�o�u8n;�u8�"w��z����u�e����]w� f�h� �w���ݣ����^�q)ͳ��a�lj��s���􉸧ލ�uj|ԋ��^dx���:xٻ��x��z"��d��_3r l=� ��>4���x�ѯ�d�@e3�h� (�y�gf�c�3,8,�v��� f����j>��:�"x~4�c9�!(��h�b�i�v�t) ��޹n4��i��sd�"n �tuzә9��e�l�7,��aae�8<�ߴ���%u�8�i�(e'`�9jz��pid(�fsp�����x�����xn qȴd)twk�!c?�j��/d�;�n�3�f��pf�%)t�6���e��^��*��4"���'���8�5�ǰ��̟�����c8ԛ��dh�� ���=��i��������)s g�2�/����;av�5�k]�k쥺� �i�e!%�y�x�0e� �db�m��ma�ℓ�f�q h��_�#fy�i�m�b�u6�jh�z� o7�bf�q��v&�f��=mo���'��̃�|қ�$[i��k�#�~���p�<�/�e�%t��u��s{3��>5�5'�qev���=�ٕ�-���w��� ϟz�� ��,����x���se��x�ᓐ�s����j ���-48�z- |��0�}h��^���z8�����v�3��yg�2*�� s/ko?��z�{'�zz�5�w:w9s%��gme �6��p�}�x�tk����1>����c�ad���m�(� ]������u�tܪ^��й�����)j�he�6e%f��:7b=c��l��-r���`���)��>Ÿ��uv�~<,i^� �kiptε����q� �g' �&���*`� h��ks�&?���t]-'{�4wf�f��q�����8���4#�t�k�v[���� n!(�w�ό��a�c�n4�1~`6u����'��>��:�����8{i`buq�dmyڪ�x ��nxf�:�ڸujh��jv\���xi�|�!�.7��["��v<��ٲ^ j����x9k�]��cu�'�6q-~᫸�n¡��ˋ �v���lv��ly۪��z,���p"�hfǜ�l�t�cli�f2��t-}e9|��whm��7����&�eq}v�e�]5���x<�'�2�������/�� �}���a��r��=z�= 8�>��-�j�{��~�\��t�;@6_7"dp�~:m�h�j��x���� �s��r� f io�<5vo�s���1�p�i"}�l�� ��b�j���t'۪�9��{گ�l1�c�w�x&��`?��;�y�dz!��-9�*x�f��͜��v�%���"�[���s[���`��h��z�������w†b��8��3~��)*���1�ŋ�aɋ_�g7�m�w��ҁ��u�e�*3_e[�g��xv��k�eħn^�u|��ƞ� ���$k�uaz��� c�oru���o:k�� �5�u�~9��bw�[���$�x�<{�/l&5��%�{�� ��4�w@�a�'��o�� �#\���d�>b��ܞ t47��i_ f� ���ui%n2~g�����¦��xl]��hx�i���f\�b��h |a�v�yl�j�b�~ǯ��>��$��vڐ��x-'[����y��%����a ��[u�������k�$&r��2 �f�!������̤c�q�f�u��>ts�i�p�i3 m�o�_s�gak��i1,!�%�wgb�̜?�i���\%z~�}p�j�4�9��� �q=(꫗���т�o�n�pkw��'^x���z�e��vչ\p�z�j��dz�kk��b7߰��w�fq����k�i�byu�p�x�{���-���ق�4d.� �o��/h��ˮ�9\ӑ�˸�o\#m`�픪�����^ 5�ߝ2�ϳ#,����^�w��^�i���3ڭ���,l��)?�0ma'�"c�^�([������m:�h��♝�3_$? �-�l6�ex��uh�us;yيwț�j&�=���nu6�����'��� k��{� vnu\$�t7m�@��_�n�v)٤qe��*×���n o��; �8=�ǻ�"����"��4k/������d堎0�n0t�k/~r��mj{���r����w�|���l�>����ɓ�܌������ �f��a�o�i�m(-<���> �d.�.�_~n����4�x\z��0$������������.� h�i�us��4����; ������x5^ɵ��zo�c�#�_m�x�^y�0���59'�}fm�sxa|v���֩�di�x�e�d��d�?���w޴ue��t$��&s6%��)����蕈*�ӻ����ʜ3ky� 5��5�s����:��ty�}6n���ig��9$���e�\:&aw���#[�qq9�m��\����i���^�"��d >@�[�fs��b�j-h�)��_�w{�dmmo�-��<ƴi@�h����"�,�t�7vu�}gac~m-�ˉ"���m��nj&�[�v'�(��a��g����v{fat �m� d}�/��zkj�ߧ���h 36���s��kyưn���a�$�\,h��7���_��2�oz������� �&i����;�i4�m����6qݰ|�ן�v23j%sv�d�����3c,d�,��b;a�-�mco�l�9eba�nݎhd�����k�'�o"�b�f,�su y�!½��-b�x���]�#����!���w��g��}cl�b�b4�w9&ҥ#6����?�a!*wr����h��o&���p��o�6���؛8x@dw��e��ty����a�4f����nn�τ6�n�n1)�u��[�*x<�dy��\i�pjtє3�����:�1|5�tc@�}�h�ˠ$1�pcܟ��>�hc%�|"=x��6��}f~�n�1� �?-j���n�~��eƀ���kh�����p�_���c���,��qn�1\}��%��i�`�����/m���q�~��)�}����c^����o����z���fi��~bt�����a�"ak3����k�㵔��|;����4�1��ncb3�t���|�) ��^(d����,!&�d���d�(������m��~����s�>���=���dlli ~k��_�`�?���k � c��glz�5�h��j��;h�^mdvoo�#jt|�#��ine��0~�������b}��$:o��d�|���޹��d�nt�gʕ��l�`b��'��s�l�4g9d�ͩ�� ����"�3���`���ϖz�&7�#n!$u�8�(< ܠ�)9i���cbh�r5��htma�ȕ�@]�u@l��m#i�]��|���w��ʫ�7�[�����ք�e��:_�� �o.��b64y�ƙu �d�gmu������f��� �(p�*t��3�v���^�m-,�oʋ��j�e�%ݥ�"5^�֞���r�k�0�q��ʬo��ħm���`�y���&�y%/�{u���g���c�����[�f�k�����-���/��?_nk?�mta\�,�o��m��w��[\>u e) ��������1�%o����^�4��[� �n5bc��y�{v�?7�;#�x҈ؘwl�8 �ou���<�:�����j6b�!�2�����f���{��hm�v��2��� ��_>���:v.�p��u��j����} <��`��!����[�!�m��< ���o���o:�櫲wipq�l� š�"r���a�%)�%n��oj�,�� ~��o����/�j-؇��$g���88oּu4�p6~k ���c8�����>_� �k[v���jmxcj�º��b�gm��ק@b��ɧs�@e��>�1����° �m��jq;�bk�d���&��͢cs7_�ٽe�]kg�y��j��x�_���ن�����ux�2��w��僁�nˊ1d�_.4cmχ��w��.��1_4'�[�1qi>��_��#�ni�_x;�z7�q"��v��-���ڝf:.>y;�(��985��fe��t��z��۟��a���~.r��m����"̖�������j��nm���?�]���u<��_��"��րu/āv _��/j?�h�*:�ˑv�n��%��^�ڿr_����q����:*��q�(tsy���9��q4��cy ��~@�� z0]n��}#d�k�`��6�s���u��}��0\�tg�m��up�2ȇl�h�aa#b����n]�(�5�q(m�ѯ`�2s��ֈ��1���؛�e�*θ��)|�0m����f���(��)��� )ɞ�{{���!��mb�9����\c����$n��pt}��ba�s��w���~i��v��l��0ĵ8�^�:c����(�q�d ��\���k ~�ѽ�s���ٶ��g��q� �#��� z�=�xz�r�z�h�ѷ:��xy�z�m-�y��.�}y�ii���h������<\��ly������-�*�����xtj>d��į���g�؛�n?�]�[��9,��ô���|�\2���f]���|��pc�0�'�l������i� [x�`s�r�f:3���~��g�o ���}����c�����n������7 y ���4�so�}9e�."!'3?&�x >� ���x v�籞�pr>,�t��x�95es�h��c�ne�� ���t ac��dh�wpr�o � zg�f�e��j&c�eׅr9�x�ҹf�����>�jm�]��x�#u���stw:�^w>����v3u[:@�z���m��7���a{��b:���3ε'u$�����n���r5�n="�k��h�47��&��h���(�g k��a}(ݍ�>׹�jчz3�*������#�i-��%;�f�$q^��y��s3����� )�v������h.l�^���1�u�#�u�x[qvy u�8�ͥ�5w��s�t���z�0��jg�e��䌩�a#*p �ū>�1��x4�c#�6�ljl���kh:$߄/n?��u�����>i���wsu��2k3���%��#��ш�a��}��p�?�%���p]-�a%/ ��}}k�(�g��ia��,nj��g�����~vb�q���:ûxxc��뾺���lf$(��k���`�ykl*�h�k���=ĝ��{��)<�m9f]�(ֆ �[�6�ryn�<�] �k�)����n�w?2� ����f���]\��'i��g��&���)e��s�qӆo^0ӵ9ݔ���j˜�nts��)%�^j4��0�����۰�j)�ro�&���[� �by ���#����pu��=5c��v��f1�ch��ēf�ዤo������y���]h,�՘c�9g�� )ɬ�o�*�����b2�ߥs�`摐}1���nƙb��se#�^h��p� �u�j�!2��i]f�9yu���-o�*i &8� ���/x�h�y�*j���ۿ� ^?��o���z]�pdj�̇9�}s_p�w�k�����c�h���e:wt���� #yi�꜂ppp�ka/�w_���~�x��ᦼ���t��!&��~��%f�p�ĕx7�.�6q���j�df��u�(��� ��&ŋ�p����k�!����d��=�vk�ۉ�?a��y����us7����jߋ�ˡ�=�\��:pq�� @r�� ކ�i�8��ll*����h-1"?)�|��m�ri��m�"oj"��km`��l�_u/,��hl��m���i�rc�5�u��z>j���l���?�ao("i�� c����p����ʔ�/���j�lh�dzbd�w�~r�����ls���[��me�r�v�ٲr[��w����۽зe1 �����#8�xcfq)z�d� y�k.mwcp��-h�߮0 m����eat?a� �]�;�_=��ubk瑐�������n8k6���-�f�'e5>��ר;]w��~�̆��z��?�� �vdz�����!�?��u��~�e�q�'~cg83~���c�� g����\���z1�m�eyտ-mn��ay�x1o��ԗ����*�5ʀ���d {|h�� �g�$����l�n����*�l�ޢ���3wz�� w�@�w����c~����8���f��i�^o����vq�һ�afk��n����"?��x]<�}�$�&x��3&m�u�ԧ�b�_��=�x/����%�-s8��1@(ӄ]����[z���h���#�k��)?�lbs�j�e���8!c�w���d�]��5�7�����-az[�q���n���> ƒ�� v�ju�sc"�����86� �� żm�1���ڳo��k�6��u;���9���:fі�����~'zw��>�����'�� �o �� ���r��,�u{� jꄘ��n����� �g��"<�d���?:v����[&vt����w��jw�΄~������1�=[�c#,��xmz����c�n�1vur6y��aw�6z��\�_e-��5�q�$��ho�g���������i#x! $�>�� �^5���jo_ǀ�%��;x�k��:,2f��mw�^�6���x6��ߤ���m��̑�w�zm��wy#`���j�_ %��o�5a��d��n: ��#ɗ-�grӷkҍkxt3 ,"�%c�jé.ӏ�&�tm���i�}1y�&q���mz\*f[ek ,y1��"�~��-b���7pe�i�)e� 7)������vvv�>�q"�1��;�� ܲ>�e�1� ��i����h��"|��g&����#�d�n4=�[�4��4��ڳ��&�x��" ��ڟ�)}���d6�� y�)(th�� ��/�)�$eem�p�et����i��t�u�lӫ�q �v���̑$`{y��/���s�e����h�({�˖s�i[(h㪨~��ȧ?z�0 ��e� ?��y�d/a�5q�����d$�<�i?�����hg�v`j��ijt9�޲kˤ:ëp��o��t��"�����e�&��w ��"���:>[t��q��u�\��l��`�m��3'��b q����ə��$i���(m�������� �d(-��� ����p� !����tc��4~�k�����{q�47 ��<�#]�ѝo��;�#�t�q�1��g��wx��`�6dokh���jt�ўҹ�8ls临ۜj:e� ��r�-a\b�n�,��"ͻ�-qe��ӂ�&��p��5�[;�0�^�,0h��|�v֑�~�p�m��m�?a�@�r��b���y�����:�bo�_� ��3q?9v�1m����бߔ�[�f3x��1�<��`}�}3�ۂ�����2�l�|e��7�;!�����jtt�c�}�t�rhm˔v�ik��w Ž.�$ ��hiv2�e5\�ԍ�\�*�m�c�� sz; ����\iأ�-�܉)d�?m��~8�o��m���7���%^֑n��rdxm��}fkh.�sqls{�� �pg�ϐw��jj��j�t��ٔ �/�� o���rtŏx�ydu���|b, a��6z�y�3�d��oɯ2|c�y1�� ��f�^� '99��l1��#�"�_���e’�d*�u�x4b���w-\��r��d}�e��,*�:��?�o��z�^}loj�mbi�[�⦻n�tbe]4����8kb�ba{��l���zd� �=؜w�{�;�⺮�fҫ �y�d��l5oր*���$�a�,��8��������o {oes"fim�;:�ȳ,�nf�w�o��,r7٪7�n)��s�{î��e $y�wm�d`�p�5ƌ�����u�/��� i ۅw��k��n�.b��9��b �������⟟�u��m�fhnj�>.�_2�ckd5~w��iيo��l'��u�(}�zt�k��<����wk�;��`m � �9��ςk����~r-*pfk�iz���0��c�:��*�� n`9d�f�4��w�n��s�ki�v��kk�!������o�|a�����m�iq�b�!���.�t��b�:��l �7nw�j� >gz�� �p�����,&\g#����s�:�j,[�hh��b�x���ü�b_(ξ|�y'����i��&�z��/*þ_m�(r��im�)�y ��y���ٺ������n���f�t�� �k� ������aj��0��� ���fm���q_�"s" �u��h���lg�9_�����ӓ��ds�s���m�^<���pme=�zg5`���*τn��h���d��;յtd��_@ %ki��&)� e�c>ly�?��jl,�6u� r�u��`����h��r�z����6w�ɹx �j�ΰ��v�}z�]�wz�)��!��t}چ�b�js�_�xau�su]�8�nk�i��2<s'g��� ��!�'��za&���?��@�����o����5 :e�׊�(��3w�y42ϋ��z�-���h���ҧ������ؗ״5�rn�.�iyӛ]@v�4�{��n5��sx�$��k���d�o8����m>p|��������ܯyi,9����3}eu#�ry~���lb���"��x�1υ��4��ޏ j�}h���� ћ�.�3� ���r5�j�h[�cq%:��m`��jǃw�����4���$�@fme����ma���iʀf�]kt�ue����u���yf�6}f�iurܑ�/>盪�9 ��m\��y����l.��y'����@���3� c*#��c}�k�i�jm�ӱ �q$/���yd�)��kz�^m����s�-�y�{���5����~��et�f��p ʻ��t ���q%�!2e��m�q9�v�:b�/�4�e�k�=)z�s�\��? @��'�9d�g�v3o�< g�������ww!���y'��,�f�ov};���mf矟��gz�k�:�k��kd::���tv&ຩzyz�;�u�vkٌҫȅ�ƃ&�kzw�{8���#k���_�`r����:o�:�{n��y�_��aw� ;�ﰫ����{)����=>;�6����{u�����bf���,f�e��jl�uc�gw33������z۹�ǧw��{;^��/�� (e�;f3��g_��ޑ���|�r`��(ã��; �{鰯>�u|�]<�w��v����oz���ȟ �����x�k�ʯu�>�a����|g�ͳ���|���� ��d���ju��@� *4hp!a ( ��c� b\�dƌ 'v��p�@�=~h��k�%ҕy��j� ^|�2$d�'nd�j�q�-3��@in�p1&}9�"͑ �bź��r�@m�$�q�k�1�*ek��u�);���'u�c����$.�pq.l4��h5���ѯõ)c�*p�ғ�u����u��2�[�`إsy�7�u[5_� �h���3f�a����̺c��]qyq�h/�5{07œ��4�����w,��y�[�g\{p��� y�vh�-z����e�:>�tb��ѹ��$�o��8r,��lr*-��� >���j0[laȧ�n �?���褒bc.�a� ����4��;���dz��@�d.��������m�����^zin��$r��~z,�#��0ʐ�s ( l�/�h�o�/�sm��~�o?�b�j&�[���� 0��x��@ m��` 3�����j�r���z�;�\h4������<�d[l�ѐhrq�,���<']�k���� r>�2�6����i� ϭ��´���6-����f���l�� t�͢���jf���0��pgm=}�*�:k �m/'_y{q!\�h6vur��k9�peqtz��1��k��¬d�`$��sp2q:o��*����n�m����k\�dz�?>]�i.rų��y���n�h.~�� /��4��n2ĝp�j�)� �����e.��c-�4z��.�= b2ib����b���j���a/n�e�5_�:�9m������r�ҡ�=���q-m;�w �u�x�s;xq���q�$���q�zf���� ^♧!�� $y�qoe� �㲈�v{)���[r�pa�r� �mtͳ��0e���7�bm���d�{����z�e���ڵ��l.���ž�6��� 74ׯ^*�s�9\ժz�ݲb�0���a&b��)�,��m�67�xgni���j�"��.=l�q���.saf}������b �d��m h)pآ�b�hdٞ0�#iy����ԥ� �^�ì�>�����a�� "�]�<)��t�e9n�(e5�xe������!e1�l�cu�3����x��:��{a�������#ʖ��b���e�����^ū�gr��ܶ����<��ϲx�d�b�t��h�-��ia��]���7�ݐ� ˑ��#���,��rj�e����3$��@pw�nx{�h��ajg�z~d��2�g]�x�� �m^ś$~j���6{��wf*�j�r����c˘ ql�"����z��d�u��xhs "����нdlg��2�����-�q� �61y:�}to�f9&���b& ��dda�� pk�3���.n��֤�ŏxa'�y��c�n��-s�y��z��8 �qc�z�1z�q��,z��wg���y<���� r1�$�!����%k�jhv@�hr�&k��)r�%"u���teգ����lȕ�$�4��62���~f���%�l*��jxy$���lsc�0 r̼s?ɬ���%g� �����i9k�7hr�y��0z*,�r"'9vn������c� i���=):c� �m�?�6��9p��a6��7xb�'�n�.w�%l���f&��w� ��7f�t�$e#k�r�\�d�oj�k�ӆ$8%�j�n����iw��ei2�k�o@��y��k]�lۚm�re˹�nb�e���/s.fb~�y�b��վk������l3jd�y�w��g��s�֝���z��ۨd���!-d��~fr� �7lg��{y�)|^��� ��zp��i�wq��\k!m�hl#���c�*=yw��4�fymmm�m�l�/�ܛ5�l 6��d�lr���ά��msn�mldy\���7������]'���i�r���n����j��4oyf>t��~z�hca��s�{b�����p�sٚו'���p<��t�:i��(o�wd6��z��&�ͷ�3q�2�r8�n�nq��4��.���(�cz-���k�\c0~l;���or� ��6p�i4���e�:��쉋�e�p,�`gwh;��;�gw��f�撈�5n�l�i��g�*<ċ�b�lu����bj�dw@$5�k�f��"}lą����� ~ ��'h�c����b��m���ާ���c�e/~n.���d0%��d%l�̴ 莬����,p��ǻ�o��%�`��.�kt`�p���0>@l?�k �%� q����7���p ��h1p�gv�ϛ�>��$��i�����[x����x$ŝl�ծ�~��wp��2� �o��o�po�(.���� �j����r��6�/ׇ�\���vŋ4ɣ���. l0zf���{ b�q` ndjh�4p׈�%�.�.�z~h��k ۈ3�h ��&0�6du��1� ��&)|0�����u��if�p�μcd�� �p���"�o��" gnsl��686(�o�k�v���hn��0m�pf�o;�dp�m8tb,t��e-�ph�a *��l"� �k�r��� on�(q��pv8�f���e�>�;�\�@� �!�qjާ5h� �2�*b,�-�x�ivqhv���mn�]g�d\�";̱��j��vv�ʢw�ivj�c%�h˴�{|��xs;��\@��xd]<���p)�hs��q&�'����ew"� c�\��n�d\�[���].�n�nh�$kҭ��n/�dbl�q��9vdclqd^�l�4q��cmn)�k��t��u��f�s���|� o��.ƀ�i� tb6��%z!:��=xw�>�?ͫa<�*8$�do)�zn��2p'=i;*b�\ `�-�r�t^��l)�li���6qu��h� !<�t�3� �<��ؤ3 ݋���� ��f,k�e#p�vie:%fz$�)$�f.�b沲�,�gq�\�8��] o�����ca�@1�j�h��rp��p %��)����z�c�f閴��o'�08 �jh����2�� ~���tg>�8c�'��3c�θ <��5/9�3��v�������� �eo��|�31�d�s��"����b��g΅m�������>��j=�*fk #���-�q��il�s5�{pq�b?%@-� � �i2p�� ��̉�|��bp!2�8�'���p���-1����(v���z�q��%���l��oe��v��lޮ-rttg���#pqe.��75cv���4#��m����s9�h'wp�"��0sny�(oo2i��o���#f�u�2�ax�*�������15�%��y���f�se(eg�kt���sc���ug �e,0�ε%@�pc/u�c*�����6�l�\(�ɝ8ku�s�z�a��(�'�ri�ytv �tf�cq�,��$c�s���*�b"����/%�&�&��s��o��mt�eg{���������6k �[>3�@�k}έԬm�4 �3:(p7]bĺ/�c%"bb�� �q�����2c��<�j�#�"��v(�.tؖ35�z緬��<�5�h"��m��ҕbc�;�u�lr�4�y^?�l�s��ғ���w����,�r,$l� [�y�w#�6?�r��b�z�.#��r�>��';�c����4�cx-ؠ�ge����.�����@uc�t���e!il����p��'%�qץa,� oć57c8�����t�hp���f.�~t���y߲ug�w5�*�)��~n7jr�vl�xe�f��7~���oy�g1�@#���궋n%�cz �z_���g͖3�vsg��e�ߣ{/w�z��-�wk ���w�w��䑸���~�o���d��`�fh8��u*8�a�s���(��.���z��<����{t�w��6���ă��x��t�t.p�րm��q�� ���s�_b�듇�ć 5�t��wzj�o� ��t��t�qb�ih�q��d��c�xc��(�� w��ca q,o�j��r�c1��8�o�4$��n�5b���\h��a�t0uimu���l�_ȇ����c�bu�`xג1�w�eq�&�1ay dyx���n��s9����ie�`y�d��w��� ��4��{� �f�?���f}1j����iz7ze�j4�]�'%��������9�<�ip�xf�,��̳8���b������jz�� b��(�縓'�ymoɟo؍�m|����ㅿ��p�� lj�0�#"���*�s%(�0�q�ϛ����8�r�� �n�99� �s�f1>�f�r��k{�����3��c s� � k�aה�*m�b�8�d�0�bҕb�wm3{�m؈̏� td��q9��(�5�gj�q5ng���q��~6͝^gw"& �ӿ��,��v("�8ҍ�5�)�w� ��t ��sdz�j��f��\ǚ��ԅkk�y�v� ��8$��u��)��n3o��e�����oc�3�7uʓցt�~�j�ׅ�i�ٌ:fk���z�'����$��u�;z� ��xm�&�����i�pai�,tf��l'�o���{�`���2��.g��f���ěx����(��{n�; �gn�e��1�����uʉ�ڕ��.p �x�g84>�v��x#�up� ��zj��ێ�z��g�ۧ�"pulb]���h�"�u��h��43n��`ب��_��ۆ��-���-a��ra�t���~sd�py�bͮⱦ�� >�zj�c̬�j� �#_����q��zit>o)��s��dz�n~�հh���o�o)���΍�4��9��dzz�3���x�����j]�����0 �"��w~�=,j�o�u�ŗ�!h��l)�s�v-�����=��w���t˔��dys眂�plq;�x<�)�c���j��̂hc��4�r�&e��h�cp����o}�`�exhܵ<���(~����� �*��,�� é ��!�v� &qc�� �*pq�ăh�ì�i�\�����nf��q�h�\|it�c�5���xp%s� �ve���@� ��$3�׈]�tؓ�.�# -i����]�r�;�̑;���ңa�@�*��*ī�f%�u�϶?�v 4�èe��8�ř`io|��-ó�[��zx�d�\kw l�di����l6�o�m��8��d�����w�l��d�%��f�vk�]ɰ�곒�r���w��qz�x;nd�mub�.�n� �c}��\i�f�@��vx�q�xj�&�ny��j��w�]�m֒q���u!&�.k�~��v�b4��jh]d�x(u�qed�8!c� �lbi�cd�]5p�wt�ts��r�sd��curi��m�"vt�`z�f�}"l�!�^dr]ד��%7�y9i'�u!uv�d: �]u@�f��!��^ne��y�qg ��y�&�)ik��w բ<��fce�֝d~�rkn9&�\/yf�y��\l_�(�x��pz���[e�5tuٷ�je�՝��f�pm�|xve[���u5fq�� �ߪ�h~�z`j[~��ɚb�əf)�ei�蒝bɨ�ýg܁�v�q]��֊xׅ�g�9�ʪ��`˒�v��jzt@{�b�v��9[����� �f��c� x��*�%p�e�� a���h�<��b�f��ej�a�0m[w�'��s]�x[p��lp5�t#.e�l�t��ׯ��kro��w���g��-����[6m)��k�j�`�xdjx��wn��쎜cd������g�v1���a?&fx�ga{^��d�r?�9����f _4��1s�볭���yz�90�h���eru�t� �g̍n(m<���k�n5�p�&,�:�;�q iur?)c��vh��]�%�jm9������(�[��z&9�0f)�r�p�7��x�k�q i�2��t&>|#�=ĸ5�i0w�����i#&b��v��\ @�2k��a��%w����ŭ(9)at� �b���l�a;"u3�c<%�qlcr��⽧��k�s�r����k���'��<�v�*�2�h'p<"x,ƿ;,"����tf[t ݠw&�l gw�s��5e�i� �n%�te����h����mdxҏm*w���q�$�d��z�1v����=�l�٥����q6����3蠏/�s�ϖ���jg!�΅fu/qkja;��4c8cխ�c����2i{��oj�w �8 6j�[���\)%t�_7�e���, !����>j)np���.����$wg��{���0r$�kj�o��r��\s��z��r�!��yj�z��y'��ger��j����3��9sb�$�\��)l�'�>r(@( � ]��~do>�j���(�b[�� e���>l�`��%��&��i����t2t�����㖠�u��ad�9w�l� ƒ���bf��/� yb� �f�x3���i!mf�q�ɫ�$�v���� �lqd�2fh���9�d d�s�gbs�2%�u��h�o�원>i�p�4� ��!t�t* r7ieszc�5b�cl�-�گ�]��"��hy�xum�� i2��l�����l^��ȵxӊ��y�ie������id�&$�rb;�n����<���7/w��q)a�i֏d)辞����̔(t(� j���m���t4�̣�3��8r��4,'e�;���3�'hs]��89=�ni� ߦenj1���"55i��r%�a�ʊ�o��ϫz̫�k� ykw��5���s���y���h�4m�kڬ�ݸ�6� l�j���te^\-�f�-���q^�8����z����� �l�$o:�˞>ݖ�6��i����i�6>e��n3��re���hmy��my��q�t���/���j>6o��g��*x�����u �{j���1�p'v�e /ĥ��v�<��]2$�]��td�b��ه̶h:i3�ҟ���;)ke�����ej3�(���q��c{]f����g��_s28�n��sici�d��n��ɷjfz����ͅⶨ�.*�� �f���f�zo����3��=�.!�r4�{q�� ,���?����l�t(ߺ�zt��-j��m��b� ��cy��?�{ڬ�~\�&7�x1&�\,�����v6���t�\z�y�۱t�kؠ�dj�'�,{�>y���m �;����w�j8�f!mx ����ej\��*�r���20�ڋ!�i�n���t�7f|(�u�o�g�e�ߴ�h�}��zapw.��6�e��p�m \�r����c~��, �~6�%9��c��r�mq�v�u!q�at<� �tb6r�ce��?�"�r�m<#d�v*�>5��.��rg�1�6}��=uv���g��j%by�&x%�vz�!/�>lgg�l� �r��x�v|sg>��r?��x�bf�1�c6mfp�n��rx4<��s�m9��b$��s��t]b[f�ն9pqu�s�t�à#�\�& ��)��tv�5�v,o��f�odq#�u83h�#(��f.�!ns�q|��#�ed�rvmtl}e����y���65�ljcpd�|=�҇h�a}��}�f!�7x�)�vf(5�7c� �~��zp�~�4w[�uܳw�&g^�2�a�v�xy�ƅz�r8��l$sv�;-հ��o�b���a=d�g\a!̴�ja�c~��m�����r��bp��p�b����,g��'o��}я�v��#��w�gx[e��&�gg�*4mky��d���1��&�w�d��t�!���5b�%d�d��p�������ㆲuqh~�&�rqx��wz�e�q ~���}�a�, ��в�~f�e�d5�'�q���8a��n�s f�����8����sh�a!�����jgt���({��3��v&�����t�f[�xe�h�)n&/͘(�6$�m/��x�!�p�~������s|ea�ry�t��z�x!��_�wv<(z����� ȇ�f&u �8y((6������qi��m2c��4���"���������^iwd�%���w��g5����r�2t(�a"9mc���ti8a��?�zpx�>�t�v�g �b������c��@�ĕ�vp��rbf�3�8jﳇd�so%h)��׃l�$n�z���#`�1�wx�?z�gї��^���ii��^�g5����n����d4����9a�i��������ɯ���)@7�`� 5�s§y��q���(48�&k �1� v%7�"���'�����!璥d��k�m�%!�ip�p�o.u�:�ýux0d�q'�>ç�9b��mz���|��۩��m�a�0ם#�r�5f iadi̴�5f�f�x{_��w}�� ٧,$���8g�y�iqhǜ�z%�~1�)�)h�d��i����!|a�nx�_2��*ij��d��%�y����n4b�*p�sj�5��a�Ԫ�ր�⊑ǥ �ic��rx���c"r�dqxz��܂s�g7s����c���6'�hd¡��3��d�9�cs%��xyow-t�0{��j�� 5je �d?���t� � %�ux��4nve�ʭ΢f�jyu�v��x�@�0��{^u,%#��€8�v�z��x��s[�s{i}q�g�ť��tq�6h �t��g�]">zhd@�/�?a4�\�]ւzm1���upt��q*_rs����مԉ�b�r��z�?��k�b#��f�޷y�j1v��k�hl`� ��� �h~1 e��2c݋�y�kz�����҈,d<�jv��?���q�&�����<��^�mbvoգ�"��rrbq"1��w�ze�cyh��}���� ���8nwsjr�����w}�����enr���q�"�9�a��^�����z�6��g&�9���e[d��j�����,�v�*�r�7�"$ҵ��j�32�öchr�� �x7w��?;��zdh��@�%�f<��khc�l<)o���2-��bsŭr}uw �,�ڰnjksj�el��(|*�o �f���f��9�c5<(�~9�܂�b��,���b�ch�p���z5���y����r {���%y�:��٤.��;l/j ��:[>��jy���� ������ (jr�c�cȩ����#r3���@�s��i|y�u�홽*�� b�uq ����e�9��� ���`��8��9~ʷe�~�he�(��r�d�ȫ|'ܤ�b!��o|��xay�[ ��\-r�ك�ʪ��jq�p�=ɲ� ȹ��ҏ��n��}ę )|��7�,r�̓����h���;hg�y�,�qeʼnk�!p���y��[��jx�/ت��'����o=����ɓ���т���ñ�����s��i�)bd_ o3���c�]�l���q*s\�-���k��~�����9m���;��^7qΐï{����q��ғ�w�ǥ��-`�h�\>zʀ�hs���`x$|��?���ĸ),�9��i0ż`� c�ȡ��da)n^l�8�rԪj���t�v(ť|��f�%�e>�g� �'�g��eqh� �p�$f �'i,�x�c g�p��saz��չ(ǿ�r��0�bb�3|" � ަp� g�٪�c�:^�������� ���$�8*���;�x�~ m�q'n����z�\� ��9�9�� h�����7�3m�r� �bc�ȥ�tm���sa�(��'j�7:�v�w�j~&�beҟp��-�a��^c�pg�y��0d�( ��m�u�- �x������?ǩ/�&d������6�b���䍳���l^��b��s��u.߶·�g2[n���4y����l�kƒd����e� � ��8��}�-z�'�ܾ���zƹ�n9?� w� ���� b���ˆ�^�n�~��ޔ��{� ����8 ���b>� �oj �!�ڪw�^md���(�<յ޲w�r��^�����˘���$�..� ?���>i̞�y�(8l��yo�z3waf?��0=<�%��e�����=�l���ެ�,�b�ɞk������}u{�"dh��jg g�=�p֝�zk��?��z�6��!unzepi c4�3bel��a�05�#�>���/������ob�v�r�23�j���u��!a�@�vz l��p!ƒ |�����$ x(��[qlhс�^%:�h���0y�%j� ��qfʂc&ĩ�#͗'m�d�izd(p�ȑi&, ѣk� gb��s�v� ,�`g�q�̉u���7-lꔣj�?m�d6#^�su��z�cb�y{.� v�n����y2�]�2�˙�ד0o�e<�-ì[l*d���fju�ث9=�\�p �ss��\�#l� �5��j���6��d[j �|�kz�m3�ޭ�z���e7b���:����b�=�uo��)�dh��z)���t�!�$��3�/��)�jm��x2 ��8� ��t�4��ȗ�v�p�t$q;�4[���dt�/��-�� ��l�.��d<�3�h��7#�� g�~hȫ���a��"�@��zꪆp[n:�j��gcr)��&��&� kӵ5�jfus�� �9�ҏ�,�l�!��s ���k�����9� �̲���?�pk�.�h mc� �-�� z�1��j��ݎjeӏ�ܳ&�"�r�pus%���@��u��z�k]�3���j�p�|cr�nh��u̡bes����2��:l* �ԓb����vp�pxr��3�z��3$�n_��܇z�6nr��k�v2u�ыfodx5v&�y�l�4qkp�ό܃��=�[����6��n�l��`� _v<��ԩ߯�||��$��n�ø��ҹb=�9⒲�eon;�m�<&��1o`))�a~�49-�enr�ǥu��s���j��0��.gb�t�74̄�bי�����ч�ܻ��g�h 3v����ph�c��x��!�j�#%���w7����j�"�d�� c|�7�[g�������i�;��ըp�rhc�ʕ��p�t���7�v9��$z��f�>5m<�<�_��͈��\�0�gfd ����:y��n, ֘&2u�s��t9wbn��3o�<]���w֭4:�(vi����s2��]p���r6�����|gp4m!q�ٯz4���n~\�ąq:it��i���ƶ�tc)l{։��a��kr�ȫ��6bv ��(�s��{� � cw�}�|i�$�"�tf�,�-�{�w�@v�=�*`�����d��zx�*�"m��]�r#�q��imm���12�6�|:�̌!t��v�vz��r-�|�/�o ��gk�d�5����� p�"h,��'t7e 6"& *�5scyi,���d1t\��z��@���0c�rt��?y�ccq��gj埤���p��b,�}�ތje�6�������� �r��t ٖ��dž��3� ��}���a�d�cha��k� _�l�`����8 �7>)�-��]�,��}�k�,�u�o �r���r~܃4p�ș�� �zca>j�@���1t�o�4�ڬ��<���#��d�bua{px%���i��-�m��b�^�ꋘ��o�˰ҽ �b��@�@k6���\%@@g}uhh�����n)ti��v���ljae{{��hg �z������� r �k&&x&���z��� (�.�� �c��3��q�v @{[({j�rs�ɩ2*i��7i�@���k.�p?��$ t�&i@��۝��l�,4���7�z��k���/�� �c���l�j*/��?ki�:*,�[� :��@�:��ȼ�ϸ� ���4i�?����#�>��@c����7���@c�b��a�k�����뾡2.�p@��>�x�v2�� <�:�y�d���c��,;j� 1��%�;�ӱ������ 9�j��k��?a�#�d%��6���y��3�[)��%����c,l�@o�<�� �Ž*:�@�b���,? ̭�%��@��@i1 ���y��=,a��ĉ�0g��h2�z� \4��i������}z � ��n�(� #�< �d�&����"yf�5��� d!�ѩv�=[̩:��°�1,��j�v��~�3�{c�xcw��̒�3�di��y@�3ia��3����f� ������q�t7@i_�����ѹ�ttn�b�3�*>�i24e����k�d��{��=��jz\?�;��ۤ��e���_|i�f���kâ��q�|��b�g�6�af��j��k<��#[9 ʃj�t��ң22��rԋs�i� ć9b ����xd�kjq\�knj�ǿ"�crg�be�a�7�΃�g�2d䜅�-to�4�:v�'�%l��ʦzd�v ez�v��=b��h�4;�@��9�,�k߉����i���c<͝f��5a<��=�gԋy�7tçt�g��`4��� � lľ|���g�;i�8n����b��k��s�v�z8�ic$�ʻ�r��(�x��eha'����dottgm�%ø���k�r|�yet!�s���7�l�`�s�e�; ��$6t"�a���)m��d�d�h u�v�ʋ?�4cplr[%5��ӿ�1kҁ�ır��"�*��ao�'�32��˱`�ș̌�ap�9!<�lpo�t�(��ԫ���?�od�=li4�ьhpt,�u��t9��c4ajlv�bső�szk�|\��5�1:a��4i�ɺ�b#��z#xedq��օ�v��"�]�5ïd#�m��x�td��m��p%�as�#����r��yu� ӎ�w�0,�����ֈ�k��@5�u��v;�w.�ġ4a�x�� $ ��щ>;=df��z �|,ۀzm m@t���a�֮���h$og�ѩյ�p?eq����ma]e �e%s�[� �|d�bk��l$�)�q������=u���q�#eվ�ax}�>ŋ���{[��<�x̓�u��c� 5�l=�k�id��>t�?2�tb-?4�a�ˬ]�^n��ӳ���տ#u���-�/�<�\_����,d"έ�u��m�j<�(֊�e ؕuۙ��c��ul�uh����f�=���^f� j<�!ќ޶�^�՚��[���w�^b�b<�p�#_���䱪�qvfv�� l�%vdd�o���ӣ�'o�έ��|���[� ܮ�a/�`�̢n��)uf �f��|~���3,�;���xdd�5�yv4�ϝ^ \n^�1�n��.�u�� ����4=%,�a�8t=,�!����v���eoh��8�=v9�41f����xa�`x6^e#m�83c"�@�ey�_��[���?��@�q�n�>ed&��]俥�"e]peq���<����ͻ�� f5x)�c��嗌]� y5�[��u=輳�;�]�3�].ޕx�n�1�=�<����`>���~�#�wjfü���f*c��] ��(�������r&��f��]m-���&��]`�`d�"6�>?e6d0ax��s[��⁐h�e��@�n`�}l�ݎ7�  �d���b�m_�nrt/l���n�|��]2)d�����#ր��s�����n�b�(�����mfe}7m]�6��5�t%a��;%��f��kƕ��ϝ�fa�1n� otugd��j^�-w�%މ�х"6�v.ͷ�}��b�"����-g��r�&s�}iv�藼e��vd&�i�x߶`՟f?�҃*ej���=����% ��g��׎mzpm��e���c�vn���j���#f]e4�m�r毈q�ll3�]�z�[�t������gnz��y|�7�p{|푈m���t��[¤��.jr�߆�3?g n'��9����en�u�n�f�6h꽴���u�v�561iwy��1���tr�m���-johy�p��o��_�o���m`qs��~�f�ui�9�\��aqpf=�9o������]d��x9�h%�p�xg~q c^�.��l?�sŀtq��q���� o��=c^�whx.��d%�h�@r�^d�eѳ555 �i�rr�s �/[bya-_.���~��5�%s4s5��u_d�8��]�jf�9�u{��*��lc��nf9�tm�^��v~ўs��bt��傕$i�p�@�t_!��u�z��:x�.wp��*�rr7l)atw��?lu�l�x_޽5�uvb���\w�]����g���`�nb�qcgz��ȯo����g/� ���lq��l�l�٨�=v�؝�x}�x�dy�@ъ�v� lxp!�� x� ‡#jt��`��"\x"��x!���cȓa�\(rdg�$ >�9�jw�ty� �/w.�xt���|�ypi̚=",j�dl�fe��it�x����bq�'q��)��g��.>5ض%m�x��8�ȋfqf�y�h�?׊�r�ʻ$ke=��o�7/�2��"ƨ0i��,qpg�k�*7.�h9fl��f� z�լ��b�c���j�%ۍ0w ܊�wj�#cgehkvf��^��5j��#��ջd�~���^��d�[w�s�^�7�w@s29rgt�d|���k 6x�lq%tc)�s_w%7�i z�`i�š\e$�m���xvqgr���h���qn8�d j$y�`[�qvf��u�x�b7mg�~ �8�\vʀ��ڍfۓh�f^�f�s.6��]˱����d�x{j�ˁ&'kj �{�&[��ix>�vr�qe`r�'�m��������%��aw�(j��ss�u���%�&�r[o�s\��z m5u��v�u�ڧwq��y��� ��\e_�p���擒�=w�vr�hxva�8�hpy�a��'��]�qq��]j�_��a�g �ldf�ܦ��n.��ؔ/µr���c��l��u�[%�h�i~u�g��mtr�fi���l�r�a�� �{�ej���}䕁�-��\��%]���wu���e���c�����ky�rђ=�#�� h�mg���f�p��h!w6-h�\멛] ��v��ڧ���u ܊��|�`ɍ�!�}&l��[�f'g��� n[�՚��rn��*^��_*����'�`i�~n蠇^�zҏ�1%f��q�� m�uf�.���u8���ke�r~�la��w�%k~qm�ћ�:��2�cx,��,t����ն���ӡ��ԩo;h����"n��i��ν�r��,��y�)5ugz�:��ns�% nk���� ��?�`��� ��t,`p�њ�d��!lt@��o&&��lb� ����(�<}�xc�1�`/)'�i�9�1�a0s`p�s��� z���d���0h\l�g�u��$�jk��\�a��4у�ƭ���fl&��*�g�a�l��p§64��p�#cʣ,���nx�x�����n����.��jx$z ��ӹ�$ ��[ �c9/�n��nl<������ �d������ں�֨��ne��t� �ǎm�d���ӑenp�~咗����qyz���t�f�������d�񄢋p�ǻ�k2����g4���mhֹ\ߴ�jx�p���=u�4m��tek�����q��� h���!zռ���]�8�o��&n������n���ttf���e���[1��#}a���b�k���w|�n���sam�4��y��kq��hh'j���a��h冋��z�lh����՘..��h�q�m���tැk� v��tp�ћ������u��xyo��z���.^z� �dl]�g���8���\x�vٍa�d] ������e(#dl�e�o<[�]d�� ��f�p{u�q������&*]�p�����b�!�)j.����� ��$ՙ#!���!��"�`al�y�b�ɯ��7z�:�6n��!$r�fm��t%�� �����u�ř�"���1� ���b:e ��s��ym�� c��t��(q�e �m�lvbv<㵁�4�ȭu�oܙ�a���x:%g�%@�c�� 9r�b�:�g�h��m�;����#��=� �#�y?�@�v�y9� &�n���p�[���igd>�ye�$k�d��l�l��0���dy�\�yǃ��v�����cl�ki��� �]�����&r�ډ�ydo��\�g�pޥ�s�uh�d���ur�ub^v”�0��\�t]gx� y��� zbx!�o$ɕ�a � ]�pr���q���q��af(���[g���a鋱�rv������m���hiv��ɲ�h��y���𼆒%gndj�6j�u�e���)m4���#�e�����(ӳ�d�`q������бy^!i���[!����o �o�j����pn�ix�$���)b0�8rm8k�!��oq����]2����c,�^w�#�g�k(��y�kz��zfv2[&�u���ne�^g^r�bu���� ,��q��άģ�fo���a�l�}�%d�mֿ�n����ѡ^/f�1i����m���y|b3�̀4�< �e�ϭ��y������b]�,�i��ǻh���z(h�� "^еz�-ڊ�he � ��j�ǃ5p�-f���0ď�d��y ��h ��[�zĝ"op�)��q �h&�]��$q,dn��-��tpw��m��l*2��� ���qjy*�ʼnu���j������۰j����`na�>���г�bh��f�� �h�ħ�`��5����ȱ��pbs�rȱ.�ne�j> ��j\ &�z r��ٌf��nh�fǹ�灮���#�ў��ɓ]1���uhdܟi� �kk�l�<��v�^�sl�h.lx5�>�2���ȫt,;�����&��th�b,=���b���ؤϰ��扰���e�����r�w5���ۭ�&t��a��f �ˈd�]í���e҂ �1m����khm��t-�:��n�1��և*�s��h��o�h�l����q�mtk� _���b�e��� �����%��n�#^�e>k�n$\�$��ߟ-�����#����b�_2�)�d���}���tv��-xt���*���bse�l _� o��qo&�"�����ؒj��a�b�n�mk��\_��h�s1y�0�naب�ʺn�{̙�j��ڈ���u�0�:�$��k� {[ v/�l������እ=3�j�(��`ej|u�dtj�pm��*�0�q ۿa���? ���ye����_�q����l͊���f�o �}a�;ژvĩ�a��1�jo� �� �4�)")��)q�lҽ �g/tlzk���bj'2� �t<����$b���=� ���� -�t��n�[�㹴�����s�v�[�.��b1�շ��˼���qbmǖ����3/��1���k�ji����a�j:�(�#�d#k$���9[vx�%ۣ�f�a�oe��2њe�-f)��lf4o����2� ��h������-[d��r�s� �0�4�3r2�[��,s �3w�9 c�r�}1�v���-���k�ު(��� ���d����n��\��.�桶h�͇�ڳ&�\> �#�n?� @ ��~���ی��v�9��c��{�%u y4fet�m��v�q� v�hgƃ��>ajڰk x����� ��l�a��4����'�ko��(��p��q��ޅc$�5'#x�dit��%^�"q/0( �wp�s�`�0g0�x�ay�zɬ�u��[�q��ec������9f��$����j�k�u�dijr�q�q���"tbl�ũwl�3ǵ��qp� �t,�������w.j0ŗ�8� p1�-h��β����t�׎ᑲ���)�l.[b���f��\��ԓ�a�����a��zh2 u����ֈ��eant_�y{��dt3q~�r�0�7�����ʃxe���� �d xw�)���ƌ[qp�٘���y`t-w�e�ktz9s�)4/j!�ɢ2��.džjt*)u,z�|u��3��_�hj�l��q΋ n���efio0��t��d�$[�����e����it��p@�d{g�m���tر�et�=�2��� mz��b��@ɲ"�h���� ӏ��oco;f�w���?�s,�pg��]`qa��@s yx-eg{�� ԥph���h����s����f��kfz�vh��r^�9�j�p��h)��y�}��� ���lkr(qj����-���[[��2�ݫ�#��(��x� y��2=~,i:{?i�~{�������m��,g�ӱmj������ŭ�:�ծezqi�ҍ�-h��[�[뱄,�l�n�"6=st����zf�gʹ�\�����p�k�ej�� @�bu��@�l�@�@�z%t8p�å [ق��d��b0�"ãg�lx$ayѡ̃, �ت!c�a������f*�) �i���$�qeɦy����ς #�j�5�²8 �$�s%ӑha�uj�#j�x���dĕ���h����~ܘu�f�!;�귡�y�"�$tk/�x)��ر�ˈ�s����k\�kʲ��,@� tpdv���' ��i�ջp�k\ks�z.d�u�d{���y�3��qbʗ�ի�$�z��n����2����';�ňs���t�0��"q��v��-�%3p֥2�p0a.��d�c���f6�ʊv#�mh:������i� �����dsr x�g-��f~�c�e��c�� c�����hg�1������*��i�v��m'��a�ߪ�����t(:����őrf�f�܍0�)uqhf�i l�'�յ�h�i�ȗd��.jpt�h�����_���lr���չ��c7�ŧ��g�����kt!ir�squ� � l bt��홥'i������j)�t ����> ��}�!�n%��0�|ݫ�r�y�oj} �hŕ�~ dq���2<=г��ve��ia3u�����pj"�d �t‹qg�"�f�έqt��#n��(ة�w�a���(�7̈ �mg]�d�4�j�v��(����c�����d����d`l�7ųo ~1�k���a*6gpt���: -dd��������0�q ��!�:�\$��-�'^c�w(�na�h�r'j¶ud�g"���g�tj��-̦*v����t=��jd��>v�џ��b�c%j.��{��ɖm�ŋ�[7�͜�5�aޚ��a�1?¡u8���v����#姨���-kys#�i����7�"�t��yrn{u��*��n�gfr}���f�i�b#pqr���gf������]�&�j�,0ӛ��h~{���%�eq-rhq�[��b0>j�\� �̊(nm��j�ې`�i{s�{l�&w��������9�b�q���]��s&?�;z\�c�<`�6k<�kx�?}�,/����~x� ͥ$4!�c ����7q�f�����2"սct*��j�4�ϫ�[f���dڡ��s�������c�dh���en�ҥ�(��$v�o�܌��*�j���b{1 �qn�#�/'`* ot��w �!n�������x�9��vrd����$xf�ϝte$fn���1f �fpj��<��(�_ӎ1w��rpsgu����a1�j��v�6o ��� �w؇e���r�>��֙",q�� n�af:ǔ!�[�"[�n�i���m8|n�x]�����pg$,p����85z_���*ȕ�!�qym���t�g�0�x;{� t�v�����y[b��d_툉u@���t��g�ۛ��u�dž1���(���e>2� sxug��k��r�w�492is�o��p�oӿ1�es��ymg��7�k��ߨ����������w��x�p��j��<����̋�y� `�=@��rt���we��q���)z�5���|ϥ�������ݬ�0c�(�gd*��6���.���i��bn n!n������$��r brjv,n��d���̭���(b�_h�ܢ�pp�0@g�.�r��b�o����onirn�t*d|�^ފyfb�x��*�%ϋ'�.�����ttd�����2��;ˆ����:imbb����j�o��n�n0����l���)�p�2�.n��z���m�jg����˭z���i�h���2l�\xj�*�../c��8�-¬��x�v�h�h�u �9&$��e�� ��$j�f �j��h4�7p5ō��v���m�r��6���� b��0�zf� �bh��l��h;2k��n�/�΅��do����bhk����i?l��ڤ=/��� �� �p k��%�� c�pӧ�0;���m�� �������p@"�t�ױ�^ ϗ uem��;����w8e�l)e�t�ԭ1�*1 �.�\����5&n&c'i�0wem�; �q$��-�� 㱾���� iq��/ g�>�&���ӯqyj�� �.��b q�*� af�� ����.��2�pcd ����1��f��k �� �:h񢒟�$q��z��w0q��l.e��u��^k&k�� �ea$$��&���i��n�� }f���w|�/i���y�m!��d�� ��,� �v�q.�юkw�q��k����_��ʊ����px��?0p$�p�z (܋�p�]��<*�%%�vک��&*��$� ��v?���( ���h�$��d,"dn9mk��\'��ۂ��r# wg� p5�ĸ�ܸ�i$ �,���ޓ������z�&�fm�� g&��kj�l&��n�.�j>o6��$ �nn,��d�^��4�f��w��lv��ćj���rbjld�s�,���.q�o'n���™t%"cr"y�����*�ҩ0nm�����l����k�~�⮂�6ɱn�y������db0���d��d'ӆc/�y�'�(�bpxb�΍4ˋy��x.���'��p��2=��~^��\bp�� �����ȝ��n�.g��p��/g� ��#t`�b��e% �x�n{p,��!r�o�]�q�jb@�y��㒨k� e:��n�w�c=kk�ґ�� ���5n����glfzz�u�"vbs$��8hb0��l��j�&���iat4�z��|�q*�4$p!��c�h��$ei��*$s���8��0�.$\��fd ���dnvgoj�y��b$l%plm�"��!��>�do-@$�6�m%�� i1҆ �a2o*��o)&@���-r ew� ��k ^"���>%k��l����jw�����d��p�98u7��p !\ �z�l��l\'��1&&9ӣ*�t6zex����v����#j�e_��v�m��:��)ԉ��'8tcg�"?�3��$��ά��\q�l��u�5d�buryy�oű:/cdbgկ\�3dwi֕n3 p�u�^�hd�{�n�s_��`"f��,�9dv@ů&�7ҷ��3�iab�b�2y1��4`�"4��� m�xg&�2�*��z��rc�4ey���r�f �'g�b��2��7]oh�d46� i��;�br%$!#������i�v/�t_х� j�k lclg�l�ry�h1�v 7�d �5bfn�n˯�{wo��^�9�h w-uc��8 ���d�rm��o���{.w���6�x��s{4�x�t��t�c'�)�q��e��hl�:uk��y�3�r�w�<*o���բ�x��x�utai��"�b����gww�z���t{o����]y|w�|��5�ʈ������7���>�os(kn�#�w}'�6�wx�l7z�t:th`��bmx� ��4�k��f��� f�w� 6c��k���׎i�eռyrsx"��:�g�f�y��nf� 9�pu.��z�g%��l�o�y�ѹzf� ebײ.�^�2۫� $�jƭ��t:�a���dp���(r(����#����s����j���p%��v��sl�et�����u ����#�t��a�#ql��m�'��sws�ph� �l��^pe;�t?@�,4� yd���do7ӆդq�eߏo�&��f�� zr�i˕;�i7d����n��� ��*uar�ar��6m�:e�(�� �g�k�#������hvp*�y��v2dk���<�f��f�f}w����넌���ìr腐�,v��4�s��p��f rk�s�<�;a���d� jslvu�f�k� �l���wz��č�"qc.�y��^�����m�ze����mnj��? e��^��?n����l�o�.vv�址39��-�ca�i��g46x�a��9z��:_�^me�p���㺍5ov�;��-my�c�a�i��3�ir�:���{{��(��q�4q�y�]�� �����/�ø�����n̳�lj��9㷀��qs\_ �i<��v�q�� z0k��|чo��p��!��%���{v�1zp���μ���c:s�|vv�|:n�0������e�rrt�e�u�d��㯍ژ�g����1ieo$=�cҕj9���i�y���-#�nd�j��j�ؑ�(�}��� w���`��$u֝����r���|]؁��]���]&��n��� ��u��ݦ�>﫝k�m,�e�om�e������|�f��ת�����]&�_@9 �{8�]ϟ�5�e�ʒ%ߍiߟ��3� k7j�a�ױ"~�l��%w�t\�yۣ���ˌ��s`�p�c�����ou�b ,p�u�vd� �a�!�h0!v/:�ժ�@v d 1cè�d�0!�� c���#a�"i���1'dy= bdu�gky�( ���`iv�z�l�!͖<�"��bg�(}�,�a�������s�®*�"(�r�/�l��&ۏ ˊ�.n���9�"�u&^�� �n��i�hn�c�rf��2i��:yv�p� w��q �a��f8�nj� [e=�db�0gg[0��� ��8y p��f�ks���b���2�-[x7���^�{kj� 8c�eo�eɵ��׿�w�րi�w�y���g���]\���[� (�`�%r-��lru�r)�|#mb)��u�d�^�5�x_�v[p�a�j\1� ԋ`���e�]t�r�4w��)�a"av]v9>bk�%�j6]�ѓ�}�u�yt$g> eд,�&᝜]�cde�h�dn��x�9�%f n)�u4~�u-�a�xl0�5�a��x\j��%����2q�l��b�%�#vd�rcc�uli��ڗ�"��k i]r������y� �w���}����l�tu�6�{����@�e䀢 �(vk�4^���r�w�v�qq��cu5٦�j6�i�xbi��6*�҂n ��knw)}e� �\��vӂ�v5 tş��e�i.��r��ؒ9�b�>��c敱��r�o��6 iwburg�uv~a��� �i%q~��,�bk��>l������2�e85%t��p�1�&�g�������d@=����5 7�-��wzruv�;{�����4���t#�2cy�dk�(ԋ�d�@!eҍ��͟�,���t�r�l���ӑ�Š�e�9���q��{��q���6qw��ÿ�iq���)c~�8��8=-gw]3��t����|d�(լyz�j��rޮ�=ґ�5␜�j�d�t��bu����ȶ*g�i/ �����?���)���g�5 �\ *��"s$��)2f9�����{̳����jk5iu^�rumq� w7ƭ:�����.�ӏj3�qmd}�� ��±��� s"�(��܇@8ixd�����g�shy|�dm t.�ˋ�e �y�k�"�����r��tq���2 �y�j����oc���h�c�� 05��� ge0�č\to\fx:��&c��x�@h5ʜfe:ї�� � �j�����q�i�e���es_��÷or�j��� ��i���2��]l`x�eigd�7cֻb��3��6c�iw��� ��o2&fdx��7�����x��s͵�e� <�$��bڄ0� g�s�8�g;�ĥ\^�,��qem��6xf��ir�a�vs@ș��;�&�5�%r�9�&��j�2?�[|xe���huljb߷ϯ)�;�����-�0�<7[���1p� b�z#<ô�e�s)qdm�h!�e>~<"��ji =g��l�2경j��r��gy��3a��5����8����z�t�1ie�uc,�m�u^����e.k��'"�k�zn�о1�ykk��� �f�iq8��nԣ����>����`))r~�/��c 5=vnf�܉#s!�nƽ�/"� �9ot��]�p@�o �4hea�ep�u ��ujc�%��p�#| �,z0f��κ���3,q�,#�~������td -��f%����nلs u�`n]m}���a)�b��qw�o)�a�s�f�&;�mwl(t����%����j�x�7��8��=��������\oc�d�xo�4#}�ziq��4oj� �t;��ʔ��z�͢� �!x�|��q9�:�c��:� acs=k�"�kl2oh�4�]1�ϕ�i�wѓyҿ��-�� �-ٜ� �ȇ�]��n�s�gw~yg�qn���g�$�r�n��l.���:��,��l�p�:�̱t��*\�rׅ eu�cij��˂���y�z�"wӝv�ag�p�o��� �o6f��k=ng�� h����)��j�jwj�d۵u���n��z�x0rs���]����s� qt�z~�ai«�s���q ���c��zh�[7u�� �a��r�̿#�0ˬ�����z��8����|>�)����jjw��z:{��b�vh�)4�t��!������m�r�d�r@����f�lpa7����im>ћ�m��mwzu>�,�t����u��͏ �c��u� d��x��w٪1�z��لqo;~ثz;va�2��x�w�0��������~�wb������d��d#�rw�9�u��|��u��t9qk.�y-�k��l!6�),�b9#�etxl�s�z�1s�á#�,nth�q_4u(�2j�hxua&wxtw#c!6q[�l��f�s�k 7:]f1k!f?�g�ff�'g�u^��f�fdaf�#�&d�w�g)1v��v^�-��y��b-.�)�un1��>�m�e6��=�"s�u���x��&�&fa�{"{�#js#6]b"'0�&e&\�cbeӷ��jtu��tf�� w�oq�9�[�v�v���.�s��/rk‚l�js�_��.��0ȁ8�q�g��&oqxo]�>co؋txy��8�\�,�e�7)�c��ew�qf'�~*���us(:��g=f\��x7hs9�w;(]p7�@8d^�!�t�8��p�to��e�)c�as�shfppޤ��ąq�sr�秀aqe �q��n�"h��մh�|�ge_�:zhv�� �y!�g[ӈiϕ�sw�9èe�����bq�%�hm�y��|c�x|�tyf's�ok������%tr����'1�j� o��|r)�l�g�c��fd���ǘ|��2ȍ�(v�%1nh'|��1��qfi��m���2@��u����oz�)�ezo�b� 7���\�'i�jl7�bk�p��x�ĕ�g��w#�.cm��j[�a�����iw�70ى�(kgu޵��h�|��0�@��� (�b)r�s��ihb��nw�((a��=fz�� ݴ���g�!��y.�ś�xxgq�s&�]���v�5�/�b|��d�֩yg�;3�x����|i�ʃpp�2�e�>�jwx����yg.����!��[g�a�ee}j��֢�������s���� �`�v,y4�j�ah�_9�l�j9s�����қ�w��$��w��/�elո��i�izfŝ�(��d���dg�����-� �餺��z�r���>�i��מh��9!�ْ zk�ɏ��nc��^�h�i~���}54)��lhn�ׂ�u��dsif�*��.�7,vz�y�-�6v "�j$jv(jc�f�8�qθ�rbx���xw�ɍi��y���9r$)�[�c[֑�!^�'b�)ԋ�o|�$/�&ªk?�*������j�� n���z4�y� �mv���p[����q����c��oj��ٮ�壱ԛ�zuʙ����jo�v���m���rny4:�zj������؂q6�8k���uj�8�zj%q^86�k�ӣ n��c�넀ԋ�tfs�� ������|�y�f� [��s�)��j�h�p! 0��k��u���9�air�z�sf�-��������g6�g�t���b���(% ɯaz�*���jb���9��[�@u�37bi�5�zojj�z������b��mk�w�a��([�@��w�n��c8�c��g7kz9[q���"�> ���?*q9c� f�i�� ĵg(�8��ȇ(9�bk��$�د�g��z��1b�"�h�e�s��~�h��� ������z~� ���!:�i%~yܑx�w�q�q�����} �z� �)fݳ�^լ�;���"�lh���q�@��[�-{pw���t�jp²��q����4��,��|l��l�îg�� �� @��h�p`���‚=gr#{��a��ٽn" l�m����u���_�4)�����wlan�)r����/່�>�v/\���)|"��&���8��@����3� \�0� �{� ��|�?�����{�s���yb[ y��:s&���h��j1g���q�i��fq��d��i�������p����ee���ï����ꧣk��ؙ�,���`#��b��tհ��w���8k��ܧ#��=\�'�|j���r��g��,ř֭f�hlo�w�#1�h�ib�5#�1i�ǝl��� ���f.� ��,s�ѽju݂��[��,�n{����- �|,��5@��z�y<��(�^���z��<@��a�av��`a� �� �&�[���,�0l�\���rvx�b���9�҂ c-�/m�pm�r�=�im���e1̞��c��j�f�� �`��� *~ݰ� ��6�s<�3�t�ӂ],{��#d�<���* �l �em�&�������l��2�ql�g�������v�d4�r���љ�:,�f8�lq���ȍۢm��<�8�'h|�>l�cڰ�ًug| ����h��h����h����$��ui����ъ ���b���6bϫ�#q����=��iu�������#-�ߌdu\m�c��`=[�ͱ�f�#��s��%��������r}����윌| �3���&1؅��i��o�������a:�4�$� �8���z��ֽ� |̷�լq���qn�������rm�r��̜�j��l<�ս��]��۷�ɬ?��� �p=8~ �e�����߷�������o�b���ߖk�u~�\�׸����y����b� ������x3n� ��gz�~��q��� �m�fo��]!�t���}��{й͸-�ԓ�r2n�����6��8��[�w�� }� !��b�}���>}��=ڮ��f>�ӊլ�<�z.�ļ��ȁ�-���m�l��l��h��� �;(�n�8�ޗͺ�u���il��������q����t��-/� �t���p���~�mo��o�*�m��m�k������� ���]�����͙^��%�����8���|�,8��кr�t��/����h�{?�{]ᷡ�=�g�䉮�^�y�ީn1tmٴ���s����jb�����n��,�i � ��#�}�ѭ�`މ��q������1��,�:k����� @����'_�o��k�e��._e�n��ċ��!�ΰ��o��k%� ��~�ylx;��j����za�v����p��ŀ��o�8=�ͻ� $ha �y!�р@��dl�p`c��rt�p �nlxr$w�`�j a�th��ʖa�d%q��h�2 t��&�!c��j�,�s��h�!� ��8 )w� azuu&ә�:fm�4ei�u^� �b܃&�*ek�d�_zmj1nƿ%֪u�a�h)�ej��b �������yp)��y1/ӭ>|�s�ղ8�n��y�v�)]����@�1�t:9ad�#�]y�4��ѡs%)��c�zqv?�����)���9r����s;��j.m�z��̊5�d��j��z��p�0 p���z謪�۩$�lb ��� �z⚥!��k��ܸ��k��< 还�j0@ lse���i���b�"���)��� ��t�$� �pưъ@��k����"(���� :�bj���zi0�l�6�("k�/d.g"s��g�/2�d��(���/5&�k)b�x��2˒l�"@ 3��r�i6� jk�5ͪπ�> i���і� �4�d��"8y*p#�z % �t ����-u�#w?�v�ql܈@�)f����]���>��� 3�c�̪��lc1ш��t;r�e�-r�g ��׸�*ňz�q�hh���&$����ls���mgv�x  5�bm: m�iz���Ϳ<&�x�c�dq�y�i;c�n�ē6~� x�y��6� �]��~�tg���a�e<�%�x�#^n���>s:1�(t.�a���-�gr���s(� j���s�"�&�a��d��u��gu��b߼r�&tj�6�ߣr�|��{k%�f���#��*1sri�#�m%��էj^cզx��`��r�il * ��b��݃%�� 1p9t̥y������t4�ut�@��]ߚ� mrf:��j%��\ `��af5����#���b2j�|� )y�l����.�\�sd���̲�tp���rͨ0ٯp�����*h5d���z�ٴi$�^�i$�з�s�fs�i6�q$n�8�xwv�t�g�8m_����%��#c<�%><�u�2m����id|�-gh���nr���qw*�zi�e�z̹�5𥧅�h�j,�p͝.��議�2&�i<��%�ys������\w�(�dq���s�(����1&�n�acc�-������j(h�z� ���xrb'���i��ޮ��� �mi��qx��j�7��jknk��\o��\f��*�3;i�!��h�p�s�߉(�sr�k[�� 0�e�jr��&|�9�ԗ�v� �q����ޚ]�=^���|<�l;�m�^� ��>=z6ͻ �hyv�]� - ����6�'j)�ϝn�n�s݋#�?�����4���vy�ڒ9_j�s���8�$�kf�������{j�bk �[tm�co�'x�/��������q]���lk�dk�x*:}��b �h�r��z8��=���=?������ �����>��~�ꊻc;$�`��i‹����-$�'���s?z)�v��y�c��z@ڿs���ʫ����[��c?믥x��h�� *�.ej=� �ͨq�2�j �����;i�ı����2����qi?�>y*�:h�q �r��s��!?�sv�>�>a���j�=r����� �k?� 7�[a�k��h�t�� ��j���4�{��i��k�:#^�����r��a������ ��{���;`�.�z(��@: ��ha� �@�#��/{rc���d�wz�h\��[�a�a_<<���us���¶h�!,�"4�#�?���%|�&��'���)ԫ�"(�b��)�;�#�6b$h���1,�u ���;96�=�0����5 $�� �<�(|��y�@t>���btdqkbg �nýƌ�m���7��d�2;�:w���g�c\[?e�����䃪�s7y��sbk�e��ek�)�k6g��s,ɀ3l\�@`է���4ƶl��/f��˃fڡ��ha�cű�3���"�i‹�{�d�k���ke��5d��f��- tl��<�d�d�)�\�f|ܴr6_$ɲt�4z�zi�4iҹ;������t{�c� �t�ǹ��c:z����p�i� �9�f�>�k0~qģ�:]<t�9rhջ9o��"{j�����8��l��6� �� a:͂�b���� �����q��r4�[cӏ�9n ���<�(i��k������,�l \�p��5��ό�)rkc���a3��ml��%����̹�j4e���l2�� �hü��є|i�hq��q h�� ��$�ءqݘ̌�� �����8| _\r���4ă��k�� ��o��99y �c�nkm���-3��k��n����h�o3h0 $n*�z���-ei��ٔ�$oь�샱����"r��h0ps� %�~�es���6�@r�c��k��<dž���<�-m��cë���r� �y��佛,�`n��s��kt��@u �ŕο��}�tn]v��pv����íc����vl��"8�r�xmgx;8��v\� �ȴ6�=b�ʪ���0��-���h��� ����x�tp�8�nhv�t t��fl��9��d�xeg2��ұ�mn�x�5m=}� ,y�u�t��l>hj�u� cu��� ��l0ٻ�mt��i}g�mk�xq�p�s2k��;h.m�t4\�ze�$~� >jx 蓾_l��mn=^���vh��݋��� �o�hck`��h��h'�cջe��֌ �f>��ii�n�������6m������~��f ��j��t���6c�n?�>lj@�m����u�w{-kl��m�����{k���v$��v� ��u����ff��[�3��a�p\�r�ޔflq�l:�;e}��� (�ѧ~.��o~�>�^�s h�ʘp|}r%���x���uk��d��^5%���$oam��2&���|&�@&nv%�x��r��1=,=���m9��ѫ.�tl�oc���]�uk�ܖ'��~%i2� �tjqv�xǝdh��\l^�t �²�q47ߣe!i=�!w �-�ڑ>��]���m�nr`o�@r�����@��u��� q�aw{ȓ��q1�h�x��-آn4� ��7�@�s��,b弛�l8avft ? _a���w����l�%q�2q5���^qe��{mw�d�� �@�s� r�������s�� !'u���#�$��e��sr��rwt�v����txd_n6̷k�/g�0`�^ݐ����c`t�yl,�/ejˈ{@t���dh=uu�^�=�(wus��m^qw#�s�=����#�e5o��m_v]�a����c�� s���wqv���&�v��q��k?�w�f�]���o� ���h`q��o?��zw�9��_��y�u����[�o��0p�h�f���duv�s�?ͱ�m���p/���*�l�e�&�õ�\^���2e�آĉt/gws��� �[�g� v�̜�y�f$� (p@��`��  `�a���d��"ĉj,葂��em4�q"e�/b4ّ�w,]m�x��b�(0�pfɉf�b ��˚֌hhǣ k�r�o�k�r�hҫw�t�)����a!���ků]!ux�'ĝ]yrpkgӝ��j�ax�7?���'ه4q�d�!i�m) j�c��hf�����\1�����j��)�cp5�=;u�o�y1�� 8�듉%:l���q�)[n��`u&ul�@g�%ɂۗ ��8���>�[�b "�o����;b�{�:w�=��i=v�z>��i�sf����c t6t��t�$15_d*�4�riej'�u��d^g~ �ps!�f$~%�@���f q�h�'�r���@^5��� i�p4yv��f���mh�r���-�c|��o=ɩw�u)�df�y`l���p�r�l �lp�9�sa�p� rq�)薖 �6� i�qx�mԙ�6mjfa�%��m �%^[b���\?յ(^�e֪���i�mvi���j�s���i��z�,f}�j� nz�hsѹ�vv���u*�ro�zm�6��r�ir�`6e�rm6�o���[ͩ�t�])ۛ�ņ�v��z�wdf��_y*�qi�d�~��~ ��)���tof[�z�*jtw y�fa���$j%�w2���g�p ���b�*8�bg�gau1v�g�^e�55������fwy��0��z��ez��v��h�>&�]���۶{zu�>d�n�d"�ޖe42�����5��dc�׋/� ��w���k*�|���>�ʼn(�k\��b�1`�s.�l�72�sru>���x[1ɛ'��}�sj�ht9�h�l=iu�v�-��f��p������'9�������(c�����%�!�sclz����-k�zv>�5�mmr���r�4���ls��4e4��$]�j4g pݐo���p÷�\�3�u6�s���p%��<�dj����]paii�_��9b/t�\n���mru2l݆^�����v�)�4��m�v ^���"��pt����.�/q�j"u�d��anaٞ �w����$��hx�����aځђ������n9i�o�l�)�c�����5 0g���6�u :�7l$��tlh��xg\����� t�!�b��yf}9�x�u�e��c�r딃nq��)���<�2p��o�"�x�#�l�>� `���ϭ�htt�ĥu�iqj�zj�f$i�?e̔���f�� �������-9�1~��ka�%2��t����� 2�>���v8i52q{�h$c�j�_�t��4���œqefdy3w%vq�d ���!�!�/)�j,]�%z2ɩ1�%���p1��w�m����xhj��h��p%%z�f�@�kk:�� q�s����j2#�k�ʩ�m��nȥ*; *9:v�ե�cǿ�������s�i�&(s�z����fuf&� m�����&�5f��&%#i�<;� ��&���~�&gi&?z�'e��0�x��q�3o�vi�ex�� b���tv\v �3�#�c߅�/��oxr��d<i����e��$ �iֲ�b�t]o.t�u������ǘ��x~�h��'ș�*s�4!���,"�“g �9���ul�9� ۜ��a�Ϳ�[yr1���i���d�����g�s�pp�������s r��!�� >*�s���`l"w��*v͈ΰ1�&_ i|�ҍ=�t�⛵��9'�y ��8�m�-����9�1��d/>�|'� 1ҙ�xբ��ce v&p�q�hw�%�h� ��w8*.�ɔ%hd�����k ۰����a�us 3*$�n�h�իo�!)�/�b�����]z����� w�"s �����$����eugf�l���!fn���c2ӕi��] �ky�� ��1 ���f˴ƨa��zz$����fj!�ȳ��"�as���o�<=;�3�v�hkq���s���es����z1p�<�6,25�u�������gxv�ѫ�8��o�j���!����� uisf嫠|-�q���>i�pt|e�$��:s�%miqyo�5-���8���s ��c6u����8|�o���k�ư�|����~oh� ������s]� ���}����q�����3n�e���.��9�����as�� gt�nh�r!ǣl�����a\�u � ��� ��= �l��x�@��3������< �x����ij�uļp����f[tk�ion4�э��qqw)����y�� y�g�ndd��q����el���qٽ�q�]h�]�t1�� `����q�q�k�������^�xz�i��y�61ޯx��i��]�yh�i��v�a �]ߔ�a�#�\�)���^�j�޹�����#��x-���g�m�ф�!^�����k(�5f�s0�$�m���5aai�h"�u��q"2�<�����f���_��bęs%a��@���0��8��eh��!^�bw�ki )���ýզ�а)�ٚ vgae��y���;-yɝ��?� ��ڛlo ʜ��d �t����� ��`�ՠ�a�="�.]�q]a�q�8i^��� �}��=�~�͵��i[(ya�o��~�l�%�ۑs�y݅�ݝ!������ݏ*#��<*_ܡ�a�ώ0� ����� ^^���e�#��� 鉄�iy��%fy&�u�u"r�(�p�4)�p���˸ y"��,,�� 2-�|.ˆ.v�/b��c�ql;`�yː��n�o4�dbu �_�q�䞽�z�j����`�z�^f!y�ܲu�x"�|�� ^5��x�6���h��y��b(��كu�5m�g��e����nw��)��i�����wfd���nup�цc8$v�)6h&y��5�q������!|�t~������npv��u����jh�l���s�r������ѐ�晵dƅ � ��c���)%ol?^��!�:�!�ɉ�dx��v�ld��)��iv���d$�|�s*��[z��aщ���| #�h���v�h��a��ڵ ren�fx�{p�15 ��z�\��ɍhκkj��mly��eg��2�d�d� %���y�)�qۥ���֑м&)�8d�p�½���!�i �{�xx� �����:^ i*�u��lo�٘�um����m�թ�!����`tʈ`m���9t��f��_��2�^�qh��w���j; ���q�]{������ o�ł��@����g�|������c� ��y���vyg����֟�(9u��hy�wjsm^�c�q�� ���� ����fu�tjfa} �͈b8z�=�qi< �mm�шŸ�u�wnmʮ٪��ܸ��l���u��zlj�p tt�s����y��u�f*�gjt���&��k��*�6�݈�e�p�u鵩ad�����n8����2��q�����2�t1��o ]k���y�o��l�c(o�, � lz��n(zü�m �u����`a��a���g���1�i�a���`��ct�n�y����jr�j��!�n�v��}a��n ��q��j֩�� �n��:_i s �íicd�)�~�k:�gakq\\֜�n�r�z�� ,���gŝ�e�i� \��"n �ϲ����l�r���|f{����r� d�ulj,����8��b �v�î�ed,��`k�ȡ�ɚ����f�bf��l��;~�ʊ"���j����'bnԬ��w�'�n��� ���� ��� ��p�"�j". ?�fj�4�[�a����\ln\��z�x]���٢ھ�-h� m�/ �q�g���zf����b��-��f����p�� ��s�� ����\�8��(�q)�����e s0�.���� ��o�$^��^ ^3�4� |�]b�.f����c��@�e]i8�������j_��:v&��j�^vn�� ���gn�����i@�i:����������2u���c���srp(yiݎh����m�r¶.�xo��k^g�i&��`�� �r! f3�ڈ��o%v2`�� �5 ���l�l��)zn`�e�������g�ͫ�p�3��8ۚ�em��na�����4/f��a�2��&yt�t ev�僆�;zj7.�%sz�s:�9��b�d�3�hn� q�h�}'��\���3�hy��z ����^��ym3ft�2&�e�ȝ�cu ��x 3&i�(�p8(���id���1f�n�h�q��-��ua .`{4ŵ��mg��]\j��es��bj��p�%��v�w�n͵�uo6w_x ��r�����s� ��my� �`*��a2��=��6�%���^����� qw݇��w�_y�k[#"$�`h ��)i� t(6fv|��� vi�5��sg{s6{k�5\�2�|�����'ck���<�`�x��ľ �)p�lk��4���5�s36�it������ɏ�y6�(��fx�-y��?�,� {p�vn��}��h@i�yۋ��n;�^��h `�!� �a}�a�eg(6��r>��,��k� 8i]�j���%g�" ix�@����p��:y��6��s\�a�1z��{��m�kn�l�keo��9�4z3qg�q��j�� �z��ߦ��2:��� c�n�v�#�� �qĉ�~\>�r�o�c��v�_z�|�t�̷��7������~�:�u����nx��qpwlj ��&삧��^�hw]����u:�4 ���2����/h�x�hms�=&�&�v��ί�u�8 y]��������b�w ��ޏ�8�'��v��n^�,��59c=9�*y�q)���u���b[f���b6��$eŵ���5��ӵ��d{te���ӗou۹/����� g�6�6n�� � ���6� �������ƽ������?=�wz������7l�兦�t;$u[��\w�dwg�s�)�h��.�z.�w�w/��zw�b��vy{0';ȫs�{~�k�w�dަi/d���� =�8hr=�c���ݖ��gu�e�?]�ӣqh���;<�{��ݗ� ��q�7#��5��e���|��f`wt�׸r1|�h�äe��r�=i���޸�]m ��;3�^>��q!g~g�36���/�h�^��~i�*����0�� � l�åʒ�� b� ��hеg� �bؐ!��n��q�k�#*�(0�f-e)<r!$�:d�� ��h �$pil�cor]y5��u�ܩrga�kcjli0%�,�j�m�.!��ȴ�u� p�h��ļ[i�e�%o�j��u߶cer�tw'埛e��x6�f�j��e ff�c�j����d�m�r�@�̴�)���wm�#��<�y����e_����h��ѯ�<�b�����'�� ��l�t�ˢ����9��韔 ���g�ȍy��q"�n��%�rʹ�h�<�t� ���젋n�k��>c�8˼��ɔk�1�h6è#�a�>*��9 od�v�;�8�o��l*�>�rrh1�>bj(�,��;!�#l��x,���k���p$ k�hj�'��r�9�dam$��$�7����!�2i�/�{q����� �� '�ƛ�/ �jm���c��z4�a��4ΰ8y� ��b��ǘ�̤i/ssh� -�=�l��l���@�� er�k� 9��� w��2^��p�, s ��*j���(��l���&�:���`�m�[ i3���$���$�“��� ��u���y�,sp��(�r���e�ك�e�ߺ�9�)� /�lmw���t��x#v���f���z�w�7�,p6��q����vcc�*�z�w�@�������i�,���4����u1a �- %��u�̏�s �?s0y�t��{��ޤts�z��c�ҿh�&�n�.���m�"�ɂ�;��pk�e'-m��:wo!w�)?��j�am\�m�e�0� ������/xjm���!.! ��q�f�t���nu�z��ւbepֆj ��\��d_u��үv#68]�[)y���r��.v�7� y�����œ����m�\�h��*ga^�z�99k{��'���l����)ly^��l��^�q ��e��q�����e�h�w�������u�#��hӥ���p򲋧���� ,~��bpv!�ymx�1�r�&���h: �6���d"o��8� �g�3k�v�99 j���nh�)pa�[rڶ/�min)qn�f� ��j�8���gƻ�in����v�;.�osb�r ����d��pv��f�p/늏@h��ܥ(��֦�$-ձnd��춅�٩j'�\ָ;蘅p��������dji^rr�`k73�����?�n�k�����ّ�9#��*y��ho\s2�hh�b.t�`��5�zqe�!���ga�l��)x�c�x��\s�#�û�5�?�ʃ���tk�qj*'ayc�d#ri�*l��ař����m����$p��#b�~h"$:-/pcr��d���n���:�,�d��$��owa�=at)jc�0��cl�ְ�f��pd�ɜpu�٠r�l����,�� @v� �&��mqt4����> y�v�<�skz�u-,�\5�a0'*|���;r�u�̃*��rl��&m-!� 37�lv9d��[{ȣ,q_ѫ��s4�n��e������r�#�6ew���r��,�l�ڦ/q]bn>u�s��n�h� :ز�fv���\���#_�lw,���1�zj$a�k�)9�9�f˳^}p��{ރ̪�@���k �p�*蚤�a�εne*�hy��w�ɑ2anm���n����ju�%lvh�h5���*�k�t�����s z٣v��1d�f: i\�<[��f��¬ �&�� �[rn.e�\ ��ú��csq�d97�jv�]�e-h!�ٝy)z��h��ڟȧ�ػ#�u ����"�3���/p� ޡ��[��v�26ut���&�͍o�%������/cv�`wr?��#�ki�.�^j#����l������?v��7=-�[dh^k���/t���[���utv��}�����ɴ�u���ա�hr�c#�k����x���2�������r�{n#� ��ɩf����c��(�{a�$� � �x��v�<:ӥ��� �z du��5f ���zs ��{7��jy� $��k����oj&{���g����p�>kx����9�]m�����1��ơ�ٸj�?y�o��.eb�����.�]q�we�,�q���by�;���.˖���f꘏f�{nm���\����bތ˴���n�&� �^�cշr��ʶ��}x�d�(��'d���ݹ��v���pnk"l��o�n[��iy��mozwxl���m �o'k%(^8o.b{<~ ���s-`��x���k�\�d�;���s��9&x ��o�w�����ڎ�s������)e�jo���ra�ou���y�w��'q��;���r�n�� ��i�h�xkx�l'\g��c4n |���ja�d��n�o�/�t��#����n]e �p>!h��jfb̮| !� ���0������"�갗 �.z�a�����җ&'�����������l �'^� )z����d i������,�&��]�0#���&!�"b�-�۸&s����0�'��ܼk�6����c)"�m��v�l���l.�bb fτ�]aw0��m�$��zn��l���� q�.��p.w��q��� ��ȍ�]4�4fs� �,�n�v���1 �f(�ʇ{�0�v �"q� rq�0�4������0m�6��1����!�cf�%m� �'%�n�d�6�2���bio��0:� ��]�0l�p&19�0�� �����5�h$����-�8md,/0ץ�c�2(!�%�1� ����ݱ?r q�����o��� 5zp^q#��kfj�i�b��?|� 0�?�w�.4��2��"i���.i� ����"aоxp��z�{o�1ߌ/��)o���4.#��;���������lr�ȣr.#-g� �*�b!��!uft "3b"��,rqj�;4�'�e�� �ѓ� �-l�,_�͏%m���&k�̼1!kc n��lf'wjz��Ԩs]���j@�����#��)q�'�r���f�s��<�%�rc ��m�&%��n ��)c��'�i����m��bt�� c.<��7b��q�e�p��q^8��1{ҙa.� ':4�4� aᮯ��o5���2g s���4�)v���s" -1�|��lsm!n��n�o&��>�j����3��l{��8q!h�&�o"ym!�� �a�)��r9�g�$oaȏt_�)����p;o^�tdg� [2x��:/1!���&$` m1sb��1't�(�&^ry��/�dp -%�p$ݲg��p�����b���4&�:�5!m�ɚ�3��<�\'�.j�fdi3b��t#��nh��z�(ɀ ��-�r#i2t��#�q ����/ 㾮c')(��@s��3�be����䓻��$�s`s�f;ugo��p]~e_�r#jn���x���i)�i�ե�h*{�j۵����rm���@ x��rgu@r�x�;����een5^!�r��4��z�b #[em[�9q_vq�r.1g!��$$w��p���v� h8��t�st� g��#u z��u=�[>sd{�>'��,�m0�ˆ�{m׎@1bi�1 ъx4o0�y%���[�i�m)�.�ia�h33� �^��j�ptp�s73&v�����uf3w��ha��u�)4x�����itwmk80��n 1$�ϊ�u_��n�@ծ�y�t{r�������eēa�� w��h��ușd���m6gnϊ��(�1�v�����a�y3o��|{�e�ska%���h�� .cn�vt�fi���4h�j;���q�x� x)���rg t2��a�@a؇sō�g�զ�6��b<�8�iun}� �w�vt ��mu�)����u��2��#�6�;���ry5'���su�2��^a�_&��ؒ\9 <�`'�1�t>v� �pi1��'׷\h�g|�wmō��y�v��n�y�������x�@��x�o���͔3t�j�'tx;ie�)���ga"t��t�_�gx���k�ri�r�4wj_�h��u�:k��i2d�� ?q r�p�/�e7�$�"(�4��b啢�vsc�t�gk�z*4qkㅑ�jk�*��:s�yx*e �����r�>��ut�簉e7a�����&ć�ru]�a����w���n�%�xٲ)�����qfr�t�#�a��x���d:�eqy�ϯ !��m����e���[ep2��'rt*��f�c%����lt��� /y���iy �v:k���;� ���p_�[g�>)w�h�=�r���1:�j�z7#���l׏�tw���a���@�%|� �#��y"�9(�zy%g���:�.�v��'���?g��k8y�ds�k�9#�2�v�t{v�eukc���wd�p���q��c��j?��2ozy\b���i����4�a����bim|g���6��ktvs e�tw��vr|ei/=u��\�n���xjfz��׀ȼ3���'���8�}׮ӽ*�a�dhaz#�8s��qu�{^r-�'k"�kqn55�yt{�u�u��y(�1~����zanf� �sa;��7�$���]3bw�03g�:ѩ��ɇ!�$�!��f���jf��n�a<;��gj;�i�֬q3��x�� �:�7|�:��؃g[����� 59�n� 5��veu��nˑzy;)��z �ĝ�z#=�/�#؇��96��>�� g�w��d�т��pۂߞ�d�4_��0��6�}5h��j��u�]w�j���wk<*��c-�k�qe�po_l)�)� �uݥur) g���[���4��n�;��7����z��;�ܮ����<�b˛��q��;�hod�|��g�s�����7��8�<�a����$�4��xw��=v�{6���-~@�5�%wn�y�n7����{4= �=�}]]]� #=���ҁuq1]b{n��c4�afq���i]�l�q/t���՗�փ׃����y�jas�uavq��ab�i�� ��{��܄�m�]�1�nv�c�������x�����������"sbʽg�������yp"�_w�a�5{�1; ���}�x����@���r�h �lhq�z����:v^ԃg�4��ƕ�m��-��ò(��myv�q��a���lh�h����̉�b\�����y��\0���!�,:�x�lkwui�u����g�yv�k��4�d9���s�u�\���[v�ttby(v�l5i�u�`v�a�o��6c��'�u���$h�g[w�x�j����wq�e����jz=��acy�l��v�rmdbtg�%b�ye�vly��^�zo�17xz��v`ezbh#w�&`q�)�\�l�en�h�s!ek[���k0y�s�ᤓ��y�p�e�jd��b�j���:p�x�e��(%�!yd�g`�m��\o��^^e�5�j�1�ir���u~1��b�ug�����g�)��崪lv j q �k�m�ئr�mj��}wi �w_o����6��goej��w&w,�����[inq$��5�����ܛ���j_�>,��(4(��9%sv��ӛ>���ϫ�ה����^c�z���m�s:x�g3�4��b{�eٴڇ%��́�pm���l�`i�)����r7�.��o��v$_әqs�ygae��h�mg؜�o�����/���ߝ���]�o��vy'e�yg��e�.4b�vag~�(:����5y�9�jj9lyyٽ�����l|�gu�9��ä�m���b�sx�y�db�r*����09 g,5�@��l�sl��%�*� �u����p�sox�t���,mˉt֊t�m�?y�f`�3 �'z>�`�t5���w�!ō�2�%̏;@��ࢪ�|f~b���21�=�b)�h ��y'-�ӂ�� 6p8o�y�$�b���$_a��d���6g���̠�"tp�xr"� �����4@�dx8s���ҽ������ h���id��d8���f��a|r�����1>4pڪƥ�d�c}z�*���edf���ਖ� ,`���s��l$��f5��p�� m�e� i/�mi���8dpd�og9˹iqы�pt"���k�zw"�yz��tq��@ّg �hh���s��j�k�61*r�dm {l��(q�3s�gc��økh9i�d�e*3i�x�k،�=¤�3st))������������e�z�]v3z�oub��ՙ!�2�x3����v���)"j6�jb�x�ti�g�7{�_�d?���3�j�"�bls�&ctm��x���llԑ�:g�f���q��k�b��]�����cv�mf��܄j�6� �s%�fw��a�a4��?2�`��"�r��줌�� #�bua2��㱖ti�dc�mc0�p�k#��dg�:h��z�na)�z��r��zr�]nm_���,)) c@|p����f�rgጦ�2���x3!ش�t�h([z�c��b��g2t��s�d�����.�����$e�d(&� i� ��hlcp]!�q�e�i�d5�]m1�\�r,���p;mʍa2ɹ��. �ri���פ�b���y�a�k�/�)�n�5]���l�p�ȡ�qk���j�f�dn����ꠄ���c�v�? u1z`�q�߫��8h�z��4@��gl��t����u��5���j��qу]"d��x(.dt���b�_���,�β�1f�g�l�c[2푩���j5u���ѵ kls��� 2{���k�g���|{��"y�vҩ�q�ǘ�nb��vr �}b����2���nry�]������"1m�k�=d����>3���&��dy}��03!��o5�õ�^��&�,�g�u09�h��q�jf�����3n�g�"��s�?cqqt��c[i�0.�v��֧)���6�$��o�8�a� ��<��;���4�䨺�d,��tj�ǥ����.ŵ��bvo3�s3g��$*�݌t���jsv*h�z$q湪��n��g�tu�o{��j�c �e'<֍��ִ,������0sw_e�e|9.ȳ��p�_�!�6�[�gm� 3�fλ�d��yty�`zd��0���nzh�ir��6?� ��ы��;q�@��}�c��2�ʬ��lͼ�v ��o�֐zv�a���h����̏;���dx'l� ��=lr(�s��bz�-e=%bx|45�3�\b"~q�v/4�a7o���\a1��c��j�be%�u g0��p5�c��ax�or�w^�>�`�u3j�8��"t� k�ocu*�sligg�!f2��i?��l5"q��s����b��o�mxc-g"0�t@�hȷ({m�1�dfa��3wq$!�rɣp�#o�h��k�p#���7b�t6hp�?�v�1"�%1=��\�ef��`|48 �o�c�$ t`fgi��?�d,�b-�����?!�֔��dpfi��z�� ��ra�-ٲjq�r,t�o�c]t!2�7"�6i{"'��;�g��k*c{ߔl'�&�a|m�u��s�n�x5ss u$�l�v\�����8}�s�ck�bh�@�(0����n q�q�uib �~�bq d�bw3i28!?�'�!g�c�d]!bd<ȑ�f�1�;�,&sb>b����"9����ma.tu ���v��6βq��4"'hue&�)�-��c7?�4i %6h@���2r�fq��ij=|�7�兀u�"1va���iqe��`'.i}�u��#��#�  >ra%��x�ew�v������m �p�)�x'�g�u�=�2���$hf�ga��aq:�`�)a?y-2���%#�"���li��zp��� !u5b�o�z���ѕ,‚���d�w��w&j�35�s5�zlj��t��to�gby�x3�=}yfy��u��3�92@�?c�o���8.iu ���c���ֵqե��$fhy�xw�?nh���m���y�x���y zh��8j�k�<��@�i-d��a����������rh7�#��8�q�z�p� ۉf���� \���@�)a�~��:j���1g��@s ^(:1*@�q��'(����~��rh!�n�p񑠓�l�(��� ��:ȁ9 2a#���3���dc<^��]s�y_�l�n�nj%�&�8���qu�4kr����*;?ܣ��֊� ���v?r�[�n�j(���t�4zq�b�?tew|�,�`�t��aut5g�n� l�ʫ�ڃx��3�b_j��l5�?�!u � b\4)�)�j˓;���wq j�wfi�:"���k��fkx�ȥ�jd���0�\�gi��)?��܋���e֚�vͳbqǧrg4;vb"=�nb��y$ l�wbg�y 1�����a���djۇ�$׶��s�6�i��ǩ�mx5�uja��ci"�ur�5��l��� o�1%���չ2�y�?���t.�&#b�v$�y7va8:mu�"e ��7 ��uq�ș}7�s�zg÷�ҹw�b;c �dtus7<�2b�k�������� z��œ����)yw6�(#j\f)l��âk���$]3p!i�k��l�׫9*��ǟ�:v�#���x�c�cuv�k�j�`s-��z�% =�o'n/r3/ƅ �/p��gli���4ą�h���:���w,$vld�hz�||h\����%� 6y��u�eܫ&�^��{��c��`y�eet�owɬ!ћ,}�hc�$r���� ��l#�{n��t��ai ˛!�ep�<���^��|��$�_�;]�$d]��` �2�ϭ 1j&� լ��t�����,!� c�7�{����c���z��v� ��sx���fj�ʅ��ϥ���=j4��rф�;β���� ͒(��&��aщ�ѣy��}��vi�gp��mzz�)��v���ꗓ,y�b5��8������k?=8��f)�f�c��f�v(�l�z3�:z~��3s�$�h �ub���e_�3t�.������xq������/vg��*�w�ׯ���hp|�ׅr �m>}�iի�-!���;ď���mǫ�[�q�f�i��g��>��ơ&�h�=5�ig�-r��_��[q�v�=n�w����3�xeb��ۗ�8����r[݋��]��͠�qd���]v�=�ԍ���y�������w��ݩ������ţdet�� ������������d >��c�����v���ϣ���� ⛁п'`%~n'n')>b�!��⟁bf�;�3a<�d��e7�y ->~�l�4*=�st�q��njn�τ�n��p�==�̉8�u����q\~�j͈q�5['c�z65t������dޫ�%d�븮`mbo�ag{�t}^�@�!f��r|4s )w�8ѣǎ?���hŝ*��t8��ï%!���2�f�!�t��#�ek�l��ez�)�� ����*x��f�a�m�(/ȱ)qf$��uыi-"�w�e�c]�ͩ���[��`o�)�jzl؝��&�)�.b�3�*�`�۔��d)�a��/�\�jqԯ�%>��ha�*^��d�3�w�2�w��y&8ѥ��� ��*tqw�ci�u �&�à�f�(0�kn&�b"�7�`z�"�<ʉ?�n��)�",�'#�! u*��"d�/����2k�%� ��v���z��s2�%����$�� �0  ���*���e34���p���vjѫ�r��?�h);�:�(�ϸ['��*� )�h8 �j*)��:�:�x ���hjm%��ni xڬ���ی��lq����n��;��b�h,#�j̊b-e�-�8�ڔ��p ����*i=����b�i9��\��.7�.�q����׻�r%ͮ�l�aq�n���`lh�$���$r1dl����j\c�-���o؁��/rf�kėf�l�����͔j��=�~s�s�\t1�!�r��sck�a' �'p�4�� 5�2|뫊�)����c�d�њ����z����d(^` ��!���n�u*�,/֠���9�*�ȟ���':�b�6�$ٌ� i��:�@�ò �n������1'�,r� �&�,�*(f�@j�l��z0q��4��|�/7� yl����:�$w���o���ǥjpj�®�7� �9��4;.'>ҹ�śp���[݁2�$�5em�n�z���|�*�n�����^� �g��?��� la1;k/q7��ju ��e��o�$�2��m�δ�\���3��7xk=l�d$1� g! �c�#�5)jj�j�n��6q�.d)������.� �g��!��;�:�h^��q)vg�����,3�s_��#���v�у(3 �gj? �[��0ӭ%'�:�v6 o��qi] �r���)� p}䄸.v �s���n�:��k;� c_6�(�)�t�tr��hm3щa�|��2�����$�e�#2� �8ŕ ��y�r2�j�%g��j��̃� �,^[t���b:��h4ph��h�p�*�s���j��h)y��ؒ2���0�ͳ����k*y)rl�g�w �kz�:y�pprp�l�=�gx>a�a�u6�\d���qw���hv�a�o�6�n����red���f�t^*��"���l�s �g*z�@�yh�:ujk���t"�bi)z�"d肙�6�s���&�рokm�ң��etw ��47e���*n;�a�0�4�3|y�@;��9�t�u���hq0�i,҃��$�t�ԡ����]"��� ����mq�� g�2��[谀��qu����4�%j������8j�*v��# ��h�����a�%`�/wnk d3�-�q)� s��";��4l�b���h�f:�j�v�5$xŕ�*e�� 1z*{�v�k��-\� �'5j֮%i,�xn��t��1i��"����-j�!*���k��0e��� *f��y2�����͙��'r9�j��'؜|������ [�u;����u%�j�;g:���f̪d4a�o��s�h�羔8f î����w��@���b�(w�e��҆~`uf���ѣͻ�\���i��j�����t,�\tg�",*��#��r�ǩ#w{�]8ĥ����?j��,�&�zryт"f��z̮�)=�ie��w��a���c�<�8�� ��uk�g�3&�hኳ�q�?ù�`�h�<~h'\��}"^nn���k����"k��bt��7!�ib�".z��ek s��r8����av1_m�-¨˧�ri�t�>�g�j��@�&������yp�[�q���)�f�%g�z��i�7���t -e���#s��x�q`u�ut�#::ﵙ��j��q�pr#i�b�1���p���`/d��jkv��c g�-�3s"v��i���n�h�����r2�r%��h��[��s��h�hyv�i�,@����m�k}#�[�1'}ڄ��evdžk�lsg0�-�iz�y$�����cˍ��p�m5�����h�@�0\f��t1ـ�9�o-�s����x{�����ss�0�oz ��x��]�� 3s� �&d���qa�d*���\�{$*z�yl5���qf��(qiބ���.�yu]lgu�\����:���[��f��zqק���}acsk��6$���e�q:�v�n��.r�j1�� ��6ܚ�n���&q� ᰴ 3���z��@̓7�j����n 9w���b���7<ð[$�h/o3�����k�<���k �� ��u��������:�t�qq/���|r��`����<�s �#1�(u2����r ���щ�2�)��� �s�c��i"�3�!��p���bӿ_b�5��剹�мe��޸�銼�$-i��2� ��m?����z5�c�)�ti�g"���!�@�a�q �8�"2�{���; �7��@��-p�!h�)� ��!� %r�2l�}b���|��= 2�h��r0�� � �y��ȭ�y����񥻣�(l,�j#^#�e���y �cik8�1� r������dy���<6l�r��򢅳�p��h�a*��xd�лc<�c;���z� z� � �[���� *� ��)�7��3q��1��!��m�`����łaè�2| |��֩ ѩ��5���) e���� a�p����� ���dfq�$��ֻ y����"�b|��h0�a����sk2^�*r���mџ���69��x8閥 �#l�pa;>\1e�k�p��6�h������|-� �$��.����贪�n c�r�/�b�h���ε��1a ������h8�k��5�tgdl�!�gdl��2�ȍ�ms3��l2�ī�(cτ� 9�9�����<����|0k���l�،�teq�ܴ��4э{ ���z c�9 ��>d��h��qnb������a r���ʺp�/0���8��pn� �hit}0;��4"h�'e��@��.��p j�r�jio<��pľ��b���m�' ����/m�l!�j!��h!h �mz;�:�dٯp�m ��ũ�\;d���2� 2k1�:�ns)�٣�9ͭ٫wkd\x�1�6 ��o0�}�b�e z���k������.�j�(=���)��z��kk� l �q�﫾kۥ����x����@��� j26ݰ.��� �kʈds����5�}�\ϝ6��`�8i�!;�8p�ixյ6/�vu�">�!��%��6n���y�)����� �y��5y�.>�ɠ�r�p�*|c�<=��� y#��i���ΰ9dɞ���ӣ��d��m�=���y�%�hyvg������a�p_.[g��k���]���2�͌.�\ii��ҟ�g�z�������c�طc"л!����r[ nh4��)f% _pi-���2���.��i����m��b6r�c w�=r/"f��x,"��)����2� ����y2�♃��b��*s�т�%�|#���| ��\�d7��n������� ���'~y�,~/6���xڥ}�e c��a˹r ��խ���y��|a�j>&]�-��2�‰�8 �;��$���a��w���٬ �}�i�qm�~�izlǜ. �cak[i�]"�1]�q۟�@o�^;�޽߉��n��:��(��v� w��iu��ţ��u*d�3a�_�x x��2;i�\��韍��5w��a��o���vޣ�[����6����8e&�bj,�uy��o�z��׮v���ʮs����n�m�zk�; ��/�!oڪ��k�z�$zn�j�� el`�fs��e�(l�pa\n���7���1ȟ_)1�m�f�~5���4�k��lw��<��� �eu�p٢�'�f �~ؾgf{ ��:��� �m�a�)_m ����v�� k����y9�9g�z&͓| ���z�>s���i^4!��]z��-� v��k�((o�x��sl�z4��oy���xg������_��оw��pp���ft�t#��t�m��� c�^dv��&w����n.f�ƿ��&ad���y�#8�1���6b:! ��@v���?�t�b��-�""�ut"rva��jvqm=f��wgԣ/8�p_`�0�rg��u)d]���xm���8k�3j������2�k�xm�!s��d-:�~it� ![��a�b�,s,�@��:�r��c�p��d/�g�k��2� ��m��"k�<�y�ጭ�h�p j�!�s�(�x*�@� q ����q� [vɠ�/#�@w͘p����w�b&��bk�z��4���%lס�ی j ���xqf{;���-q&e�,��@��}�p���i��r6kڜ.�-bu�&�~o�di�<�x���g"$����% \�@��%q����u�v�zbj h�)dh�ǒ"!a2ذ!̆i�t8r�#��h1haa��(��ĉ�#�=!9l���ƅ6�r�2�e��v��s�e�aa���ap�9fv���w���:cb�,%��_�ēo��&t�]�w�y����n#a7�t)�yl&�6s]���b�eu��ho�"o�1�p���p��_l�7{�u�bq�arr�d�)֗�=�grh�m��p��uxșz��rk��ep��c����1�c|�&�a6yu&c�a$'u4��\[ڝ�v�w�a|{��և9�fz9^�ζ�h;�c� "_��e�f�w��� �� }j^k�6%tsf%dky����n��ʕd���[��z�{����lۚkmכ�)i��g(:���pd��bm�j�(bi눹mz��٭�d�d>���tb4�|��g&k�re,��"���đy��z�{zyk�l�>��|z)p��*n�ᒴ�v5��oahb��a�a���[������i"�i��^�]��v֬������s�����y_o~5\��j��x9� �տ�i/�{)�0r�ҩ�l�x����s��ڮͫ���i{ey˱��6c��9�i}8w�ҳ֮��q����y�n8��f�‰[�q�:'a �ei���&�� ^~o�f����t˾��'�m�yyg[b��������胷��d"�'we_۲�vli��܈�d����h.��n���7%rv�d�e�:rܖиd� a�mcb�l4��c��ydt�%��f@*��^��"� �����7o�g�l1 ��#h�u�;�9�x����ϩ}d\7i�i뒠��&��ɂu�� %�vz��im1ng��ʺt3y�"�,��r岚o�ro��3#�l�1w�l�)�ujf�0�i�y{�s�bi�ut���z�'ňxϸ�m>��nebtm곎pś�� �quh�� ���k��8'��h��� ��n�jd�1p<����r����l��� ͵:[�t>�v� fzj��c�2�k�)����]�rjn��{��ן���,e�=�5�h�eəjp[� jи�)a�[�yq�89.�r�,�qw�aid#2�@if�>���5^�doc���t��w��֙��v�ha됢t�q�!��y�7�v� ��l���r�u����r�)~g�cp�jt�w�#u���k����kgnhi��:����d��v�����jz�6��ڗ��ȷ.�-�:'����jm�!�n�$�]o����d�_�|e�7�r��v�}u �t)�[�~�c�;�6{a�f��4a6ӑ�\{����v�0ē��2`b�j��g�ze� m'�t���fa���7n�if�s ��#p�t��`2nh�,q� 2��#fō���_�'^63�2f6lq�{ǻ:�x:h:��?x`�f|&zr~-��v�o6��q%o7����in ��c4k���)a��p#����$$���u�3��r���j[�vi�t��x����|d��u���lz�b�l�ca�;�������.�0]� ������{�i�z�4�b\b��t�6]��� bfń�v��`����)ya��}^�*�)ie~��6�� �l' �d��j�$7cj��t��h%�pyjr8�h�-�y�g<9�v��3�ۓ*��hm,ӝ�e��m��� f$�[d����߽�g��ѿ%�<�m\��t����o �y���]���ĭ�2q� -e��tdș���q�r�]p��j�è\ ��]�%���q���)�ڜ�yp��b�����ql �y ߠ�t�a�_i�ۙz ߰a�dp��ؚ��h�o�d��o�e�f2�y ��jk�]s��oܙsɼy�%� ���` � �ѭ���[�qg_$^�e���1����qޥy}^n�zt����v�����w��i� f��t ��ν �� � �b%�ޓ�^&� p��(�c4�����4����d=�kw���yz��$f�'a������if��5��� zz��s�z�_�� �ń��9���!�aָl�鱗@��� � b_v_�͟i� 45aa���#,�zxh׽�\\ iq���)~\���`��!����m��z5���r��ԝ�}g�?� �dma ��(];��my��� ��!=m�؝"���^f�n&zl��ђ)�$9\����tf�و�d8��d��� �z�l�> l9���c��s���=!my�,�bn��a�4��-�\fiz�^�)2 l9��}f_g�` �9��-hհ�2r㻽 ���p#j[��a��y��td�m�" # q]��œ?��[��1�t��c.�&h�9����dkm\y�ӳt�����eth��>�ޜ�ts"�x�y�e�@�'��#�� b��i�'��*yg�@�|�yn������ %�d�'?-� ��z���1�)��z2�u��ׄɧ�4�!x�y�8����r�@jksdl�ϲxh�i��emc ~���l �ըxꢒx �\dp�m� �\\(��a��r��c �r�ف���d*�ᅚ���f���fhe�h5i�zfi�jܻu�u��@�e�hh���g[q�k��yq�n��.m&j:ā�g�ť��`z�~n\�vlz�&u��p.h��j᧎*˘�f����]�ezd*j�f���r��:a�t u.(��$��:m��t'����z�((��p��|^�z�#g����'�m}v�>ꃽo2��� �}g��ɓ.���,���d�� �<�i��|�'�>�s������g���i�r�m���*fz⋞ ��h���(m�ic�9nj�ѯe('e��))"��>��0����j��� bx���>疺\��غ 꽞ܠ��-wx�g���fqj��)szt�h/��b�ǣ�>u�����ƿ�m�~lv��������z��j����~�h�j��ܨ])�:\q��)��y٢e:l�-ѫ:l���t�������be�js���*( p����i)�f�|ڙk��o1g~�l�p������d��z�b���2�[�i�f(�y�����j1�$�ʫņ"�6̽�i8���ю�즉����!,�i� 2,�:����|!�����z|�yr��ʀŭm�#��vr��ƥ .��r� ��7�,���o6pʄ����$��l�:m�&�:-���}q�gr&m1������'�f-���r�>2*����v��r�2�ajh��vgha�.e|��ԩ� (��&�d�֦�� pr�p���dضppex�ݲ�(�ziq���*�,0��q�*� ���~.�� ���k8.xd��p�)l`�q*�0jh����e� �/�隴z>��diіd��e���kt����&�lٕ~��ͭͧ�1��g����ɓ�x2ldv��x.��#̩s*i_�gp q��r�j�bp�~�{��g2���|4���n��2d���֫��h{&��h~� �$q�>��f��b�ֆn&ch�8c��r�\�l��q/���p��젢k���6�2'g]������bh��#��щ��gh$)lq��so�è��n��nʪ'xz�j���f��e3��o��l�q���n�ng��pf�?�()l4�"� �c���u�2x!���2rlfhwop9�f�q�:��`dk��|���[�m�;�s� �/�b�n)3�ƞ�#��z�,�m��ұ��yp�m���f.�axr�1'�b'd{)��m�*(�ڰ���s4��=o��-p�9�<m&� �t�[�$�&,q� m���/��#rnb�m[���e��*�³��n��ȧo��b/�o���6�p_x�0�j�2��(�.�w 򥼚5g4x�1�b��^d�un{ �&�z74tn�m���h$��z�idg@k�l �x?p���(��2�q��u��� �ts�&�� a�i�#w��g���@��r ��0��m�2y�$†( �d�aϣmn\��dɥ3���q�ƀ�l)v q�i�4�q�҃1�rd��#b�͒\zf�њh5ք��n�p#�@���#ӕ[.dyخƿr���r�)�f�i60h�r����xsl����k�a�� �r���"o�)&(��b�-s/~0m̜r�j�:���� eg%i���u�9s^>|��gׇ-��aq��[�;��ς�7g�̶�v��s!2 ��bi>���,��v ̣��r��%��)��(���ɡ��b����� !�bt �� �/ wj���î� q �j��&ɢ�i�� �0@��iá������#� i�o�:�m&q2%d�zbn���#��������z$�gr�b�|4�a��#���$\�˗���!����k�&�mٸ�n3]\�.�h�h�g.��rl� ��p\�=�p-,�cq0��(΂<;i�� ԏ7s�pk�ri)u�xz�> ��ɼ0%����h�5k���/�`1������n��0%l)����҂l3(��ɔ^�22��--#�nz �2r�h�(�r����d�.j�f� �jq=�?��r��n�-ڮk��tb- {�m��c�z�*��q�m�e����&xmk�er� m �tu��] �i8�,�77p��9&xw��5���w��* l�tgڮ���3x.�&"���mo-4�bu�j6�;�j���mٗ���z.*>��ⱦ�4굑�%����2nojy4�{<)b��_�{��0�h��jo��q=�b��#� 4s�$�/���:p�s��� �s��� p![g}�m$�дr�o��%[b-��'� �më��ʩ�c�m���1ÿ�pl���t*/��h w �ӽt/s��l�l�ӷ�@�w�ۖ�d��lh!r �����f|p�k�矦�]���ch$a�lp � �n��h%���j�'�!*id�qw�>��qb�ȃr�sq>�b��������a�w� 4��q�p�]sf���hp:�z��хe0>��:�%��h�ʌ�����7��f�� �&��\��b����v��/x*��ojf�bb8�~kz*y�n�x ���:����t��jc��as�r*���?u�ȗ6e �d6��$ur:�5:���q���qy�h���̔�}(}��r1�9��0��g��h���vфk�`|d�k�n- �d fnn5ob ��—�0k�!3 �1 ue-e]<���׀k�lj㧛%�g�j� ����2fu�jw���4�������i2�lst��֘�m�d\4�yb�g݇�b%,qx�>|��d\ 1 ���}ŕq���h�!*�q� %o�'��`��d������vn&- �ǚ륒��ܒ�|��ov����^��]bӎ��jo:m��� r-2駹v��?~�/_�~�śæ7=w�7)>�w(��i� s!i���e�o��l�z�nn������g."t�>��`�o:��͢���gn%��ox����(�u�h���w#��*;[�p��v����̌�̨msj'��#�$�y�^�x��j���d�8�e/c�e)j�ꀕٰ��=��a���c���0r���ħ nж���̒e�x����d��j]v�t߁�t�t!d#�y�%�r�z����y� uq�x�?0j)u�[�81��p�!�sh������{a����o#jv�jcs#ud��e2�ijz�nr<��d�;%��d��d,6&,h?�jض�=��龬j��(���ndx�p=x!q�i`*"�a�ĉ����z����df�� ��{ve��9yca���$��a^���[��1cp�ܬ���>oe� �qc�b�2����q�r`t�.cq{��ߏ���m,ix�56hvio\�@��8�⧷�����kd=�ht*��a��lk�?�/u��tm��6eju���2k�,�1�z�� ףmf�>$�� ��̈6[�q�bj�����i��c}���b�ȃd��z�-fg���4�\y��&�c;��>e�f�ޠ����}c��tȫ��jɼz��͘�hb��š��s�_�' mơ!��'��̞eh��� ��b��-m�}/!wp��}q�i�[�0k4e%&���fe�i�@b��w�1oȉ?&�qn�d�#kn0�ǎ�(z�/�l��{d��a��| ����$ ���p��%�pd\b �n�p������ oin^.�hot�l}hm1�p�$}�k ��cb쇌�������-��td��nq����oe����ض�y��8��.@�ʐ�%�8,"�*�' m2�l�o朮�01%4qn8��<�l�v2gn�nq�j ȯ� ���*r#��� ��=�c��c|�%�1>�qa2n����l9��d��"�1��&ن�l��p��r=��j���=�qk��1����bo��ͼ^3�b�##�d�q�)ox�>���m1�.b 吧n�)��|01 �/��� &��hj�xv�5��c�0b��w42o� k� ��kѕybps>�g�m�d��,� yt%a�&�)�ms� ������$�c<�oen�"�3g��qr�*�)be�(ӱ"z�6hi3-%�6%�>q/�1k'b��"pd�(bs�b�b@�68 �ln�8s�jʍb�_քz�8h'��^"�zt�@y,z0k��� ��/��\����1�z�b�\3o�n'k��a�u���(}�j3k/���f=�.�p>�c�b�ij��*u���x�sr��f�e��p����_q1�v@m�q��)����r����4h)��.�h��v�f �c:l?�$vedv͕d �0��h�����߮/ ��n� ���w�����hΰ�2�/��u���bs1: pf�ap�mה����^- 6�zc��>x�w�ph�(�֍��i9�s�l�k h���ة,߈66vgf�c��kr�h�� �d�q�2�e���p�x �x��9��ޤ�m= ilg��k��|�k��$@#�o��lko#��r]�ut��6�dr��g�7�� qr�b吓}�kx�t��*7�x^�p��l�p�l��<��.���t p�'v��y��kzz��k*�0��vҟ�u��c��*tg�ҙb��cq��3���v��k���v�����4�;鷀�h����g*����u/l��@sxc�c��~�*� ol�ٴd��[ylr�uvs 8����ar�j�o�u�{~��xw�d��}��j��8b��*�j�#��u%v�k]�n�9�������<�6���f�:ˎƚ3�2pc��@**��iqd�3s��e��c��v��&��d0e��$��#t�?i�e����j~���� ;[�8z���y޸���n�y�0@[z��q�l&}rz�,��xxt��4�.?��� �yӑ��͔7�v���xm�p���r�؅�d�!����ong�^ ��x�xti p�7�`ss�h��0u%а�ғ1tǫ��"�@(u%y����#��n���@_d�ul.ey�z��n�!r9u���"�9x.���9�dnh��z4���ٵ�i9�� ��a�9����ō3!���x_�7i��%���y�� �x���-����zd�yyi3����\p�u �2����*��w��yd�y�����~�6�jq|�/��0!k�a�,�˥���r'.�z�׷i8�� ��鐺�=6m��y��� ���p��4�r��rs�μ������ �#c���cr%�vҟ���� <�e��m�dƒq7��� ��%��k>�3�xd���(��u�%��^}o� �[�e��y����q���&�x�eھ�>�e;�uf��o�fqk �/�܋��xؗ��7��^�uօ�w� ��~�2q��t��\��z�'�p��4ʻ���x�6mۤ6��z������ [��k�����!��a�]z&ac��e֣-� $�� �,y"p�a�˔1��!æ�*8�����ҥ� �%v,c��@��h-q9�tb�a*|�pi��gd�p�ě ���ež=�f����й3~��t"ʃj="uz��ɥ"wb�z�ȋc���4�ԟ.m=4���us& �i�#o�e���{1)ͱ��r\h�ќ:����\�rir�y��z�b["����,��u�jpđ�)�tx8���gq�z�q0�� 'j��v▚c[,��*a�l=�l�{u�����fvސ��zo�g�ri�?�k�;[��·�%�����@s�tz�w��1%�z�i&�#f��hd5��ot���x������f �i�95�tva�^l��p���x��7th&�m>}ӈ =�^x$yx�i�ee`i$�dʄ�y_p�u։ ud�mug�`_�%mjz��r�9��ka}�tf86��m��4�aa�qh���j*yg�hp}��eh��яprdw�1��[�]uz�!yq���w?9�_d d��vi�vs���\�i�\^z���_-� �)vؚ�1�\cpux�zv������l(�za2�u��� p��fi�t&t[]j�ymi�� ছ�y]q�n�&� i�\�v�j\��q*md���v���&v�w�y,����e�ׯ��ňu�է�����g ��j�� (r�"� ��r^�~�i#�d![/j��j�� �af3�u�;�� ���i0r&���t#�j�7g,d��q������5$�õj�ev]edi�)��)v�f��y�u�6�iu�i��&�x��dzt�}go���q�;�� j�ʃ!��ȶj�vy�����um��r'�ǜ���ğ��z�m��[�ٰٰ�*��>w�w��&6�a�� c`�� pnoۮr��`�j�z���b˚k#��!q~{�l�j���]k����,cb/'���۹�^��v x�b���q�n ��&��=�d�����s��h�r���4�u%>�����2���$.� �$33g��fxs�u�w<)���lr�|�c�u�b�����6ta� h&|�w[�c-�4�\$�i���<��f��r*�;s��/����:u�� uz��瓴iaqo��c�x������s֨d.-y�;�rn�8(1�m !�m�5pq��}|k%8���́�sg�c gg=�攖%�h$5f,�~$�#0�j"���o������"|yr `��h�b����3�f� d aolr�ff:��ј� - 9'�i�! ��n���q9b(�e�v�hg� �jr���f,�ĉs'1��� �tu�|4�g49yѓ�,��}i!~�x��p qr�r�p�x�� f�b��:��8�<� �>=c"�tj�jth������)d�b���$hk ��tr�.{�ub��䌲j8��#:�ԉ��m�d�]��j�>s�����n���ps��b�� ���!qs]b�z��؆�c�sx3a"n� єv�#0yg� �󦦠 [�i"�ԉ���n�x�z����r�z��#x� f���x?��/gi�z�� ni��"��d��/��"k��^h�gt�͸3�����= )0j���q��*�hշ�e~��b]1�r�l��sy�h#ӝ�ԙ��* ��{�s>e`b� sƣ�kg�/�������ȉjm�����������\��h�1lyk�9 ���d�s�z����w3��l1�ׁf�x>)}kj ���^���&ݛ�.j��$�%�[�ʋltiee#ٿ�v�� �h�d��vk� �x�ך˹��� �k[��ǔ� yp���79�}m��l\��p��m�|�d��)ҭ��"aw3�e�v�ݾ�s7�up�����15��5�)��˅g��$ ;��%,�s6w�os���?z�4��l�j�,�ܦf�e���:�s�̥�6\ w*�]�����l��3 itqڔ������m�ѯ��(�k��l�c:��q k4�枞 ��w*%��yq�!���.�5�b��~�8m��̑�̎t0�c�!��������e��y�bd��2:�i���âzx��c�i0�fq)��s��u�*�f��}x��^��ealԍ�h霨� �m�6�xc�lw�8f܊![�xtl!�y���'lǡe*��m��5���4����$�w��uu'�j������u���@�����= _de�@��*u����he�f'�@���y�щ����ݓ:� ���2�(�?s�-quq�>��}�wc��"������e�zg�t\�{�"l@=�#��������#�ԁs�e�3n|�y��v�g: �-qx�sox�c��pqxm�svc!r�7@hx̂��0sh|��k�d?�3g�# 0u�x��2w{�ā�t-��w9vlk4��t� '��tt4d�)�7�bhm�f؄q��4х]"�r�w^r��!i�?��wc� cg ���ri5(l%mk�(j$vquwq�b��g��f�$8$�芅�"�s?u�b c�l�x/i�s fkh�o�!)�$e7���r � 8;v�>����ɸ|��us8��'7����t@ �~⑈g��f�i���ጾ��l�{k �ר�yq���/k����r� y�9�i;�(&fk�b�&�q������n���� p�9n�8y:f�5�l���c�ԅ���-�?1����(� �f�t,�ge��pe��tc�qv���n2�ȇψz-�x��(��h��f�����v��>�*s4$ws��l43����⍷�v����v������8�z�$o���h[�ȋ����vd�0�hg��d��x׌��/�zj��(lя�g]ڨ".эm��,8��&(k�i���薁)��ci �;x<�8� x�ï$菍�t�o h���e4��?�$j��ߡ��%�� ��ym��cǒ�h kh�)�x�)��r�' �4]��d-�\腔)>d��p&�9�};�"=�t��j����u�v���)k!sv�qɍs9��h��y��b=��^y `�e%6o�84��s�v�r��(a0rip�i����f�>z�h|)oԅ�ӄ��l}臇i���u�yoz���bb?1�@t����шhp4�:�}�ȏ ь�gmi%sa�(�k��ي�g���;@�=� ��h���it"���bk�x)v��w��7���ay]sbx� q�w���~����� ��5$h��~���(p�xck`��z�ʡ.��;&?�is��7fэ{���۷�/tv��z�צ�(tz7t�lcc������i�x:�#�f����x�i�'f�����9=���'�6ho��iy vq�@x�i4xzi$�lp�:1��v�bҗ�� �ei|mpٙ=q�ce�y��$4��p�ٖé�ίd&9��u,cgr�6�t��� �^pg "��$1���fz�o���i"������m����r@��&k �8��d�2 �_ڴx7�zh�e��s"uv ��d�7s:���b$�j% ��(fje g\z�ʪ�\ɍ����`�a:ć6��k7(��$�i�p�vt�x��c)%��o!��1��j� c��&���qa)>��\9w�x���l��v����[��:*�b�0l,ŋ�9뿆�=�*28�k�-��� �h�&˪�^�w��y��k���� v(�`��"� �(���#��a��w�q����jh\\~;����ف:�����kcea\�ʆ��z��y�=��8tiؖ#h��d�y<����ll��u��u�����k����k&~�@�k��*���h|ʦ��������)�f,��j&��u����s⸟�1�dli�ǎj���s��!džj�ꉩkpmܿ��m��� � lx� �! ��h'l���7z��֓k����u�"��h_5���,��|ϳ��� t�d�|����ĩl��*� l���}��w����a��]�_\w�c��el<���q6%о��*­�l��k�gǵ�ȧx���sz,h�� u�&�����cw�j���~���ܑ� ǡ,o��\���^�gk�x����8�x�;��������#�l�^dֳ̡(��s����<��xi������;��ѩƌ�� ���<�ոj���i�q�i�ł �cx�x������k���d��;ۮ:����m��j���l����5��:�y8��ڑн�^mnj�]��x��'*��m���˗-���i��>�襸�k��9�u�͜�,���]j���-��q���mb������ ��� o��^�!���~졌᫨������=�!�#��r\����m�"�����0n���$�~�r-��c2)���>�b�}� /��ȓ�����>��f o�b%������ ���ɗaт�鎸������u�^�sm�@1���w:� 8v��ȝ�j9n�����x���6��h���ȯ�����1�%n4��$�����ߚm�ꎘ�m���h��>o�cn�\�0�kw���ۛ���3�#q�ۃ�g��7x����96�lϭ�a�ѯ��*��ǿ��_��4̎����m���*'��h���w���k�")�vol���]o�ܖ۟.�ǜ����h߿��/��.�պ�|ӿ=�&�߾�rk�ko��-�x�ѿ���l|�/�ͽ�k0�-�[�i��m ���n#tӎg%���c>y�n�ֺdк�ݍ���l=9kg�e$h�a�1հ`�%k,� �b 2ph�!�k4n�8qb��(�l�х†���8��k�)��rbk�7s����%p�o�lؑ�ο���ja�e��,��u�-�d@�@�vo:l8�πo�* {��ر$k��z��t�)��(��@�s!bu��a�g3i��֮^�f���,��$��4ղ����aorf�8�d�ys_mx/n�.k�j�)v�d o�r�\�r5u�tnj�rt��钝 j��qp�r9* s�y�|��>��;u��g��n��ˆ�n�j��m��cϡ���k��n"e1ik��k���vz�*�\�� �tr�5 �� �� 19a�n7����d�k�(kk����j�����%�íg��ĩ� q�i��xrﲜ |���������r�j�:f��3������2lr�.s�#2�c�� �j��oo���򨨖�s꿒�j�;����83k�b�ۨ30sc�šf����dlͫ� (#i g%� t��z�2c��b)�vuc�(sќ���@��7; ����x /�pc��vb �i�ii¨���t6u׸ڐx5k*u'tɋ��k��v�/��vj*�m3 �t�.o�8k�~��'%��;�-�-������<�9 �p������(�f3��a����g#�3�������q��ʀ����z0��ń7�d/w ���5�o[z��hv����l*su>��w��e ����,,��_�2���k2 w��5ˉh����&��b1 w�zhl�:�yp�� �~`xc���m�2c�fxȓ ,��^d@�2�� $߻q g���jv[���ng���w^��2^� z�cl�\b�'��p����&b��$���*�g &e&)�m�η�"�o9�����x6?je���[�*� �a�b�f7f�r&�`��@�d�o~� ,�(�b�/��`[(��e\��^b҇� �_8���t5�<��c�<ѡ>$���m$�� ��.� �y""39���vt�ӽ�h..gz_��vę2�ʌ,�� ����#plqn6����zy�#v��fr'�~: ��e1k c�$���� %mjll�k �����ȑ �yç(�r�����"ku��f:�)��r@�0`ylri������ı.�v=� �&����g�9�*if� v�:z}mc��j��k�ou(�qw嗻%e� ��%�biϙ�@^�����`��!r��w��o�����tl$uh��s1�k�/�`b�`t�k[�oc,"(9r'�i�hj�ѵ>�ᓀ���d>�d&��e�f�i@���a�(��ɗm�w%#j9b���wm��a'�”�b�o��q�i�2d��[���фl�,=<a��j� �%u���7�8� �!�e�2� �j>)��{h\��/m��t!j8h9��ζ;� ٲ�k�l�o��l�7b�t��ԣtjv� fuit�ur�����o����ql�㺖��*:�w;/��$�r�(y:���8r��;�v��=\�κ��͑�ʺ�oj��vub<�3�vr�����t��djv�$ut�����dԡ��ik g$ira'�]o�-y�ij“ou.����)��w���(ld� ����p3sx�c���d�&�c���x��#k��w6�6j��bsf �㠗ud|���̎u�jzj�j7�s�;ij̾�9���n(#co��]to�� s�䃪��9 y����&���gj�ͷz� iq��|�i&�ca��'sd�a>�t c���z�,�l�~g� ��7�l�[��i�ts�r=b�%��t�n "��2���{��mٺj�w�p��h�j�jz2 ��m�vj���m<7���t�.ży�$��o��׬���b�y�wmq,�u�d�-�#�t�c쮑�`m�*7�ݛ��{�%s�>d���� \��y��m(���#�w�8}�����&�$����� �z]��9� ���ѓ;�������|~�u���tv��}����گ��)��k���)_�4ɯ�c��r�qr6��'����q����� \� �#����=i,�j�j�� z��3|� s�ۋ�1t�x��[#ᧅ�,a[�����;���v�t�<�f�"�� "z8=��[�r�,@t��21�d j[�2/|;�1�!ϻ�]r;�?5�p���!�v��/�����r�>� dh"�|��u�a櫱��(��ڃ"y¢�#����z�<�a��b7���ld*�k�x龩���" ܫ�����j���8=ǡ��=g뛂��b�<��sc�i�3�����w ����� -���3�k�x�o���hj9��la���5яʋ&w�9�r��s&�;��s.��6y���[��@�ґ���5 .�j3 cgt�j��@�q,��< 4 ��ps��d8��1k*a��at ��[1�i- ����f�k�q;h� �3�p�m#�(b� �#� sb�a¦ˊ�k�(l�)\)�ɤ���#�b��/�#� �zc�h�8í�5�<�b' �1���8;<��`���czz�?����a���ʫc�]���p<����k�����z�ʋ*i���d9�8�5�e�"��[�s$��ߺ�ĸ���e��e�;\d��� : `�*|fպ1c\���z�e�����s$i�������f ten�o?eb��#�&2g�s6�p�c�?zm����\l��8��?�ٿ!�m������h����1ht�o�ò����°�@a��9�h�4:�� �<)˴�$a_1�.a�4�kc�>ra�*(|ig����; ʋ�ɜ�k �"™0b�j0�:;�'�>!�b��ω�����j%a��|�j"��2�4���là b�rn\�qkk�ñ1�o������q$ľ�ͱjdjy�ǃ�[8 �e)��b�&t��i�xa1�ʴ� =�z�,�җ���o�����ch뺁3��$�q>�,(��v�{�_�c�h3�$���qi��)���6�8d�,�ƀ9b��;f|<��=.v��% �$2�h��a�!�dl��ч�s��y����m �&���y��[�6q���i��kʉ7'��璫�>[��0�1�$� �ϋ�9��*�� =p]-��=��a��e^b)8�–�[�\5> ҋe �[4�-l��ke����&m�����[1l!kt�a��4�'���kv��x�l�\�ʣ=x������?d����� ] �-jl�;s���-�q��)�zx餝�(��>�/34��qk�9;����\i(�k#ňn%ɨݔ0 �j�����13 �j=�4�3[k���𛵆ؤ�r� �uc t2��s�j7b ��(���/z 0�qրq��%�sv@��t�2�m�ƺ���;����z�1�s=\yw�k�fuqŷp��:�x�����%�\i0ͭ2����" �=�:a�k���'���~�=�� ���8�"���%���]�ح�巕ӷ/)���x����z 1o�ƺ� ۣ���%���(�m��c7�3>�)g�>������t��r�g�v�9et2���|s#�z���ܳ�����ŕ�ax���oժ�4�2j�%�yu����r8�)8dln= �>\�ىr�ya�0�e��u�xi�����t��xq]��\�0�w՝o4��kg�r�ӣ�:�- }s�g��� b�:���ؿr��2���wڵ2��b&�d]b�u���&d�kc��諑d��s k]��mx�ϭ=�eq��( �q�%ql ja��� �����l�4q��2c͝��u[ ��/re�b�m��(l���  �9)��u��\d, q���b2��٭oëd}��·,��o���[_�a�u^���ԝ���� 0��g)�� čm/����[��g ��3>ƃ'�w�p��" �o] ,]:��ʯ���e��������ܣ�o&���b] r.n!����x�;ޛ�b��<�2#���e�t6��=��=���o����b��\�8�=4���,2��_����$f������_ ��av#q� �ql5<6[����c�:v ^` ���%f2����9�$���㑱lln������l��i�a��'4ѷ\ӊ.��˷�s�y�ax2�e��qbvf�s�\��c��ν �/�e\4��a>[��.�m�qj� ,��5��c�i��zc���� �yn�-�㦛ă�z?f�he�ӎ��ed3�lf����hޭi6_'d,ln���\n~/d���3�e�/�m�ں uv,v�#�xey��֥ud&�;��(�_��`6��r�b^� i[�ٶu�w��o뽂��g٭\y�o"�7�˿e�锛i9�õ�e�n:>w���(^��b�٤�\��c����s�k��°�d]�������o6��^�2:u�2᭶gȴ����!駀���fb�w����o뉚��ҳj><d��b_�m��;a#�e^���.e�ji��8`f �v�85c � �ӫf��=��u��;:�4g�%�^d@�̶br��9�o{�a�4:ö%�_ost�����r>b�`�*7vs����6a8rb���2l��%%�5*�k���yico[�l�;��c� �д������m<�;m �8=�p�<;�m�����s��.`�0cqi ��^��qv� ��v�1��h�d�j�e�p�&�ev�b�e�����e��� ^ ��8"�вys/h �l�[�\fap��sǻxθ�6�n� �r^v�tx3۪>4�m����󐔬f^��9��sq�eps�gm@wj�gc�ԉ�䧀��a�3�3y�a�����݀�ҍڨg����op�ed���%r����m�q�ˉ��m4 gy�d~:����4e�wfd#�֙�e���,��j�x8����ww����]���flk����a�v�{��)�\��x/�����j��!�je�ҷ�]0��o~w �r�^ūj";y�(��%�n�s-j$�d����� ��j�ւ��y�չn]��ke����a-i���ғ_���tu@��t�q�\k�_�1�u��������se�̘a�����d�0�@�2|x��)� --t8q���(*dp$gk��4�h��d�)an�� ���l-�i �ĝlr�dr"�ƴ$q�ƃ3l����)�h �zf�ɏmer��θ$t�#ġg�bh��єn�p�-�q*ձl�j]�t�c�z����$u�/�jm�b��w�����yθi��˖)�<8�'^��3�d9�qa�) ��xzwӗ��6��2ql�gwc��10ư^���x4��0go�i5-׬&uj�ą��g��@��k��e�ʕję�x��c�_���fa�pz ��d1e�e/���o=��^3h��b��ifp�trg�t��5�o�qw� ,-�\f�}4{�=�r�`v^nky�5�vrrw�t\ray��z'zu�k�mg�h �ԡa�):��]s2nwtr=�uut��k�}det=��j���tr��ggd���@n����u��c0�u��w�g�\妒w�1v�c��o罦�~�1�sr_�ea��ifm�$v =�v��i���nf�`�f�q�]�s� g�;-i �$�yr�xsm]�y�?��quvgj*�d�p��tfm_uj��l�c)&gs�=�i�- �9�xx�iu�z�]*j~o��\vw^t�w�_�jx�w!v�`��[������j�f��h�] ږ(�e��� �zoj}[`l�v�m���y���kw��|��1����t�[uf�g� ک�{ߥ�@��e7�,��%r���ԡ��*x��~ai��n�6����{e� ^��ף��giwx�īn�!�f�h4��:i�q�hv��b#�~�hh�9�^�v�s�r�`f�4tf��$oo�%ysvꕯ��^>9���!�h����a6�|�]�pk���gn'f��r������ke�����x�)�"����~��i�y��qb�؆��i � a��*y��vy��f��nm�r�� �*��i�ivz,�7g�4cq[kl�k�i ٺh�bҭ� ,\ iɇ�*��k��h���1�0ka�aѕ/�e�� �`���`���c����e� [��l��s$�| ��b�ck��!n��e�>c��.v��v��;ҝ�s�9o����u0mc�u��?���zl��ft8="�7'yuk�f�dv�[�f؂���4"q f�ķ7��]p��e�"���e%k� �3"���=�:�}2�j�y,ii��hf�>�h^g� ��3sb �z��adgx� nป��$7q�9=b�z��?�i����b��lxz�vd�� =/��al(k�7��'��w1�%f���/n$�`~ù��g]�q��r���0� ����mm�d�f����d�xl�k �e�h��ke�2�'6����$0��h�pd/�rn��6vl�55v�2�1^h����0t��g~�i�������?*id�����|*�n�js�w� ���h^'��9� xa���:��ssc}qm��%n=j���"wx6kh�_]r�i��\�h.e�g���52k�j�vu��u�ꬭk�bxқ m�"� {��ny%ic jvu�/m5|�o�jp�g\w�a���� e 3�zkb�3�8��cjkf3c�*~wl��d�4l#akk�br{h@iӥ�������.�b�lf�h�!x��{�%?%�&q����?96�b0j9�gg��f��6�gi� b�d�e6 df��g��2�g���$�o��t�|c$6n<��"��wd�01���h%(� pp��kn^��*�%�����cј��9�h����xx����fk�h��! ��[�x��n�{�%9z���@s'g�%(>y� #��ң>�9���p=d��v�1�ɲ`&��0��*��h�;��ps��2�%�j��)(r��@l�$�plt [�{�yj8�vl�m�k��w:���cr�=d*hz��p�$� ��{s\�ҝ��4�vϕ1ix�:][�|���i��ݞ$g%�z���� �ה�[/m�;���v��aq}sf�#e3��ܶ�種vp��|�qps`�]��e��/��͎e� c*�n����"aob�7��~ c1ot,#� �||��2e�'�i���hp����g�@>�k��,ҏs\#���'� �t��2fab wˁl�g��i}4�b�p#�t\ڐ�)�]3��2҃�y��$�hs�������g����\*a4�gy���n��шv:ִ���o,�\r�� 'l���aw�p��n!:��"cu���q�,}*鼆�5gp%c����2����y�t�8]e�x��=v�͘p��\[ �˨��g<����y��q���ƹ�d�yĺ��`����d�$qh�ۖ؛�јd�[l��li͒��s \�����i�9�k ��<� ��d�,w�=��[gh�`�_ǁhv�eș��ad� ���y��|���q �մ�t|)��,�}՚�\����q��e�����x�-]�,�l9t���kh`u�́���]d ���u�|�ӂ�xҙ�r1f۹�������]k�}�c����xu��r�������yݍv-�����$ʔiop�~x�i`����g@a�d�^���@����]�!i�&-�c���wc�h��텖h��j��*�qp�-�����5��4���z�i����}�)���ј��e�m����_u����.!ȝ}�]��dٷ1��)zd�߯�� � �y�k�e�2�������j��˭t�i<���� ��[��[�� �����������d�`�}e�%��4�id]��v9��$�������yt�4���d��\�� �xx�u�th�x줫��f�� eo(��_���@ekm�ziʼn���eg�v�e�l�tj�c����䐺pv�e b�e$����(y���p�t�8�dl, ha�]5#�<��@y�5s�0��i��ɜ�s}ek�m�r9���')%�y��z��x`ÿh��2w\i���jehv� mxaw vud[�kpcur�q 6�q(����&ݖ��_g:բpۅb��x�y�#:�](p����xrab���d��\�u����-���-k5��p1�c(�4�p�h���%����g�f���d��qxha��dp�y�tu�����h�]x�f��xo�#��燴�5y�p�axx# �be�m z��`{e'g� urn����ґ��x��z v�� 0�gb� yjg��ez�� hi<�yxǧ@� �\�\��w\l�x�x��z��i��kt��ƣڡ#������'�<���piȇmm����i��qh�r@�l�m�x<됙�z��kڝ�q�ϊ$tlo�hּ�a����glc�k}хp0`d�r�v���5n�h��a�i&i�ɥ"k~d����� ���`�g��,gyd�ﱓ����t �p��.z�zl#*��ugn0���g�� ]le������р�f�ݬ��p&���ܞy)������e(�q���/�x��%%�c���h��*�:�jd(�c�ꋬc�f�-���mnf� w����x\e����ʞ&cq.�q�n�9e ]�����z���9���n�v 3�h�i(�i���yikp��po�h����)��y����nm�(�0� ȑ�ԁk)��t�e^ffk� �e0�p�8����t�]і�a`�l�h�o,��8�ϕe�}q[� i1i�4nmrk%a�e�>���hd� �,ik��_r :��k���c吲�w��a� }��\�ng��3َ��h j����?��k�yx�n�$em��m\�xtj���slfp����c���er/��v�ֽ�8�f�݉ �5���qt�ъf�w��_���!ۅj'�q�m%l��o$�mpk��&s>�85⇠hz=l��yii ne�]w��| ���h���^��c ���ʕ?�:h�����l� �h��ɴ ���d ��2 ��:��b4 �ok�o6ٯ�� �']��*dϟm�~ z��0ŏ�[��a |���q�o��y��)ӵ�i���� rݑբ�� � s�ie�që { w�j�ua=ڌ�"� ztw4�y`�%�a,1`4���� *"e&��am.s�c�qx��gh�/�se��v�j�%���6�l�����l�:&r\���j�%^��!���q\�b��#�id2[j!��ev2f,��nmjee �2�lu(�e)g�]*y��#��ų�2�ͧ��.k���x/��� �x]j,ar;%�$m3����eѹ�4[h5i\o�x�5�'�r��s�)!̚s{ �tnd}��i5<�< =�=��z�3mw�`